Top 100 Law RSS Feeds

1. SCOTUSblog RSS Feed

RSS Feed scotusblog.com/feed   Follow RSS Blog scotusblog.com
Devoted to covering the US Supreme Court and its cases. Written by lawyers, students, and journalists, SCOTUS Blog is widely regarded as one of the nation's premier legal Internet sites.
Facebook Followers 37.5KTwitter Followers 508K Frequency 1 post / day Export RSS feeds list Get access to 250k active RSS feeds of news websites, blogs, magazines and podcasts with email contacts in 1500 niche categories. Get targeted RSS list in your niche at your fingertips. Email us the categories of RSS feeds you're interested in at anuj@feedspot.com Copy email. We'll share the list in an Excel spreadsheet or CSV format.Email us Export RSS List

2. ABA Journal RSS Feed

RSS Feed feeds.feedburner.com/abajour..   Follow RSS Blog abajournal.com
The ABA Journal, the flagship publication of the American Bar Association, delivers comprehensive coverage of legal news, analysis, and features. Edited by John O'Brien, the journal provides updates on significant legal developments and insights from numerous expert legal bloggers. The editorial team includes Kevin Davis as Managing Editor, with Victor Li and Lee Rawles serving as Assistant Managing Editors, and Debra Cassens Weiss as Senior Writer. The magazine is widely read within the legal community and also contributes to educational initiatives and legal system improvements.
Facebook Followers 26.1KTwitter Followers 107.2KInstagram Followers 7.2K Frequency 7 posts / week

3. Above the Law RSS Feed

RSS Feed abovethelaw.com/feed   Follow RSS Blog abovethelaw.com
Above the Law is a prominent legal blog that offers a behind-the-scenes look at the world of law, focusing on breaking news, insights, and commentary on legal developments and the profession's most influential personalities and institutions. Founded and published by Breaking Media, the blog features contributions from a diverse editorial team, including Staci Zaretsky, Joe Patrice, and Kathryn Rubino. Above the Law is known for its candid and often irreverent coverage of the legal industry, providing a platform for legal professionals to stay informed and engaged.
Facebook Followers 75.1KTwitter Followers 182.9K Frequency 19 posts / day

4. Lawyerist.com RSS Feed

RSS Feed feeds.feedburner.com/solosma..   Follow RSS Blog lawyerist.com
Lawyerist is home to the largest online community of solo and small-firm lawyers in the world.Their goal is to help lawyers build better law practices by bringing together a group of innovative lawyers to share ideas, experiments, and best practices.
Facebook Followers 21.7KTwitter Followers 59.2KInstagram Followers 2K Frequency 1 post / week Since Jan 2007

5. New Jersey Law Journal RSS Feed

RSS Feed feeds.feedblitz.com/law/lega..   Follow RSS Blog law.com
The New Jersey Law Journal, a prominent publication under the Law.com network, offers comprehensive coverage on legal news, developments, and insights specific to New Jersey. It aims to provide legal professionals with the critical intelligence needed to succeed in their practices. Law.com, the parent platform, supports 18 award-winning publications, delivering news, analysis, and strategy to empower legal professionals. The editorial team includes notable contributors such as David Gialanella, Business of Law, and Max Mitchell, Regional Coverage, ensuring high-quality, in-depth reporting across various legal topics.
Facebook Followers 8.9KTwitter Followers 57.8K Frequency 14 posts / day

6. The Volokh Conspiracy RSS Feed

RSS Feed reason.com/category/volokh/f..   Follow RSS Blog reason.com
The Volokh Conspiracy is a legal blog hosted by Reason, offering insightful analysis on a broad spectrum of legal and constitutional issues. Founded by Eugene Volokh, a distinguished professor of law at UCLA, the blog features contributions from a team of esteemed legal scholars and practitioners. Known for its rigorous and accessible commentary, The Volokh Conspiracy delves into complex legal debates and current judicial decisions, making it a valuable resource for both legal professionals and those interested in the law.
Facebook Followers 4.2KTwitter Followers 22.4KInstagram Followers 588 Frequency 6 posts / day

7. LawSites RSS Feed

RSS Feed lawnext.com/feed   Follow RSS Blog lawnext.com
LawNext is a blog dedicated to exploring legal technology and innovation, created by Robert Ambrogi, a seasoned lawyer and journalist. Robert has been writing about legal tech, practice, and ethics for over two decades, hosting the LawNext podcast, which features interviews with key innovators in the legal field. He also writes for Above the Law and has received numerous awards, including the Yankee Quill Award for journalism and recognition as a Legal Rebels Trailblazer by the ABA Journal.
Frequency 1 post / day

8. Harris Bricken Sliwoski LLP | Canna Law Blog RSS Feed

RSS Feed harrisbricken.com/cannalawbl..   Follow RSS Blog harrisbricken.com
The Canna Law Blog is a forum for discussing the practical aspects of cannabis law and how it impacts those involved in this growing industry. It will provide insight into how canna businesspeople can use the law to their advantage.
Facebook Followers 163.5KTwitter Followers 5.4K Frequency 1 post / week

9. The Lawyers Corner RSS Feed

RSS Feed lawyerscorner.net/feed   Follow RSS Blog lawyerscorner.net
Lawyers Corner is a comprehensive blog that aggregates legal information and commentary from various local attorneys, addressing current legal issues and providing practical advice across multiple areas of law. The blog covers a wide range of topics, including family law, personal injury, criminal defense, business law, and immigration law. It is designed to be a resource for both legal professionals and the general public, offering insights and updates on pertinent legal matters.
Facebook Followers 869 Frequency 22 posts / year

10. fourthamendment.com RSS Feed

RSS Feed   Follow RSS Blog fourthamendment.com
FourthAmendment.com is a specialized blog dedicated to the latest developments and legal interpretations of the Fourth Amendment, focusing on search and seizure law. The blog is authored by John Wesley Hall, a prominent criminal defense lawyer and recognized expert in Fourth Amendment issues. Hall's extensive legal experience provides readers with in-depth analyses of recent court decisions, legislative changes, and practical implications for law enforcement and legal practitioners. The blog serves as a valuable resource for those interested in constitutional law and criminal justice.
Frequency 13 posts / month

11. LLB Guide RSS Feed

RSS Feed llbguide.com/feed   Follow RSS Blog llbguide.com
LLBguide.com is a Professional Educational Platform providing a comprehensive guide to all LLB Subjects. Here you will find easy and helpful law-related content even if you are a student or a practicing lawyer. The site creators are focused and dedicated to making laws easy to understand for everyone by providing notes with a focus on dependability.
Frequency 4 posts / month

12. Jurists Global Blog RSS Feed

RSS Feed juristsglobal.com/f.atom   Follow RSS Blog juristsglobal.com
JURISTS GLOBAL'S vision is to make 'Legal access' democratic by making it neutral affordable and without boundaries. We are creating the world's first and the best 'Preventive Legal Care Ecosystem' for all and our mission is zero litigation and faster Solutions to all existing litigations in India and global justice seekers to meet their optimum need for support their interest of Global Presence.
Facebook Followers 55 Frequency 5 posts / week

13. Mugshot Arrests Blog RSS Feed

RSS Feed   Follow RSS Blog remove-arrests.org
We offer a variety of services to clear your criminal record online. Our experienced internet removal experts use cutting-edge tools to identify everywhere your mugshot and arrest information shows up online. Our guaranteed mugshot removal solutions will get your mugshot and arrest record off websites and search engines like Google and Bing. We guarantee that any mugshots we remove won't be republished, protecting you from future online reputation-damage related to arrests.
Facebook Followers 998PinterestLinkedInYouTube Frequency 12 posts / day Popular Post Intelius vs. Radaris: A Comparative Review Get Contact

14. The IP Law Blog RSS Feed

RSS Feed feeds.lexblog.com/TheIpLawBlog   Follow RSS Blog theiplawblog.com
The IP Law Blog, managed by Weintraub Tobin, offers expert commentary on various intellectual property issues, including copyrights, trademarks, patents, trade secrets, false advertising, and licensing. Authored by seasoned IP attorneys, the blog aims to help businesses and individuals protect their intangible assets. Key contributors include Audrey Millemann, Eric Caligiuri, Jessica Corpuz, James Kachmar, Jo Dale Carothers, and Scott Hervey, who bring extensive experience and knowledge to their analyses.
Facebook Followers 315Twitter Followers 14 Frequency 2 posts / week

15. Verdict RSS Feed

RSS Feed verdict.justia.com/feed   Follow RSS Blog verdict.justia.com
Verdict is a legal analysis blog hosted by Justia, providing expert commentary on significant legal issues and developments. Justia, headquartered in Mountain View, California, is dedicated to making law and legal resources freely accessible to everyone. Founded by Tim Stanley, a pioneer in online legal information, the blog features contributions from a distinguished editorial team including professors, attorneys, and legal scholars. Justia's mission extends beyond the blog, offering a wide range of free legal resources and marketing solutions for law firms.
Facebook Followers 3.3K Frequency 2 posts / week

16. FindLaw Legal Blogs RSS Feed

RSS Feed feeds.findlaw.com/LawAndLife   Follow RSS Blog findlaw.com
Get the latest legal news and information, and learn more about laws that impact your everyday life with FindLaw Legal Blogs. Here, Both consumers & legal professionals can find answers, insights, and updates on legal issues.
Facebook Followers 46.3KTwitter Followers 18.1KInstagram Followers 1.4K Frequency 3 posts / quarter

17. Clio RSS Feed

RSS Feed clio.com/blog/feed   Follow RSS Blog clio.com/blog
Clio was launched in 2008 by lifelong friends Jack Newton and Rian Gauvreau with the goal of transforming the practice of law for good by delivering cloud-based practice management technologies for lawyers around the world.
Facebook Followers 20KTwitter Followers 14.9KInstagram Followers 6.8K Frequency 1 post / day Since Jan 2013

18. North Carolina Criminal Law RSS Feed

RSS Feed nccriminallaw.sog.unc.edu/?f..   Follow RSS Blog nccriminallaw.sog.unc.edu
The North Carolina Criminal Law blog, hosted by the UNC School of Government, provides insightful analysis and updates on criminal law and procedure specific to North Carolina. Launched in 2009, it serves as a valuable resource for legal professionals and the public. The blog features contributions from a team of knowledgeable faculty members, including Jeffrey Welty, who has authored over 1,100 posts. Topics range from case summaries and evidence to motor vehicles and sentencing, ensuring comprehensive coverage of relevant legal issues.
Twitter Followers 6.1K Frequency 1 post / day

19. Mondaq RSS Feed

RSS Feed mondaq.com/Company/Rss?monda..   Follow RSS Blog mondaq.com
Mondaq is a premier content aggregator service that has been providing invaluable legal, regulatory, and financial insights since its establishment in 1994. Headquartered in New York and Bristol, the platform curates high-quality content from leading professional services firms worldwide, making it a vital resource for legal professionals, businesses, and consumers. Under the guidance of key figures like Chief Product Officer Richard Anderson, Mondaq delivers approximately 5,000 articles per month on diverse topics, including employment, tax, litigation, healthcare, and real estate. The platform not only disseminates critical information but also offers advanced analytics to help firms understand and optimize their content strategy, making it an indispensable tool in the legal industry.
Facebook Followers 115Twitter Followers 4.5K Frequency 30 posts / day

20. Need-to-Know News, Insights, & Intelligence for Business Leaders | JD Supra RSS Feed

RSS Feed   Follow RSS Blog jdsupra.com
JD Supra is a prominent platform founded by Aviva Cuyler in 2008, providing legal news, analysis, and commentary from a vast network of attorneys and professionals. Headquartered in San Francisco, JD Supra leverages thought leadership to offer new business opportunities, media attention, and networking for legal professionals. The platform features contributions from over 50,000 authors from leading law firms, making it a critical resource for up-to-date legal insights. JD Supra is known for its high factual reporting and minimal bias, ensuring reliable and balanced content for its readership?
Frequency 1 post / week

21. Law360 RSS Feed

RSS Feed   Follow RSS Blog law360.com
Law360 is a premier legal news service providing real-time updates and in-depth analysis on a broad spectrum of practice areas and industries. With over 350 newsroom staff and more than 200 articles published daily, it covers crucial legal developments to help professionals stay informed and make swift, strategic decisions. Law360 also features expert analysis, breaking news alerts, and custom newsletters to cater to specific interests. Its reputation for reliable, non-partisan reporting is reinforced by accolades from the American Bar Association's Legal Technology Survey Report.
Facebook Followers 6.1K Frequency 28 posts / month

22. LegalMatch RSS Feed

RSS Feed lawblog.legalmatch.com/feed   Follow RSS Blog lawblog.legalmatch.com
LegalMatch presents legal commentary on important events and ideas related to politics, society, and the law. Key topics covered are Criminal Defense, Real Estate, Immigration, Business, Personal Injury, and Government. LegalMatch is America's original attorney/client matching service.
Facebook Followers 6.9KTwitter Followers 1.7K Frequency 2 posts / week

23. Jonathan Turley Blog RSS Feed

RSS Feed jonathanturley.org/feed   Follow RSS Blog jonathanturley.org
Prof. Jonathan Turley is a nationally recognized legal scholar who has written extensively in areas ranging from constitutional law to legal theory & tort law. He writes about Constitutional Law, Environment, Free Speech, Lawyering, Politics, Religion, Supreme Court, and more.
Twitter Followers 236.4K Frequency 2 posts / day Since Aug 2007

24. How Appealing RSS Feed

RSS Feed howappealing.abovethelaw.com..   Follow RSS Blog howappealing.abovethelaw.com
How Appealing is a widely respected blog that focuses on appellate litigation, managed by Howard J. Bashman, an accomplished appellate attorney based in Willow Grove, Pennsylvania. The blog offers frequent updates on important court decisions and legal news, particularly those involving the U.S. Supreme Court and federal appellate courts. Bashman, who has extensive experience arguing before the U.S. Court of Appeals for the Third Circuit and Pennsylvania's state appellate courts, also writes a monthly column for the Legal Intelligencer and a weekly column for Law.com. Known for its timely and comprehensive coverage, How Appealing is a key resource for legal professionals and scholars interested in appellate law.
Frequency 6 posts / day

25. The Law Society RSS Feed

RSS Feed   Follow RSS Blog lawsociety.org.uk
The Law Society is the voice of solicitors, driving excellence in the profession and safeguarding the rule of law. The Law Society blog showcases work from around the organization & views from across the legal sector. Key topics covered are Public Law, Banking & Finance, Civil Litigation, Criminal Justice, Cybersecurity, GDPR, Immigration, and Social Welfare.
Facebook Followers 21KTwitter Followers 120.8KInstagram Followers 19.5K Frequency 3 posts / month

26. Lawctopus RSS Feed

RSS Feed lawctopus.com/feed   Follow RSS Blog lawctopus.com
Lawctopus is a leading online platform established in 2010, dedicated to supporting law students in India by providing comprehensive resources, including internships, jobs, courses, and career advice. Founded by Tanuj Kalia,the site expanded its reach to the UK, USA, Europe, and Australia in 2018, offering global opportunities for law students and young professionals to enhance their careers through various events and resources?
Facebook Followers 53.3KTwitter Followers 16.8KInstagram Followers 42.6K Frequency 14 posts / day Since Sep 2010

27. Patently-O RSS Feed

RSS Feed patentlyo.com/feed   Follow RSS Blog patentlyo.com
Patently-O is a leading patent law blog founded by Dennis Crouch, a law professor and former patent attorney. Established in 2004, it has become an essential resource for professionals involved in patent law, providing timely updates, detailed analyses, and insightful commentary on patent legislation, court decisions, and policy developments. The blog frequently features contributions from guest authors, including prominent legal scholars and practitioners, ensuring a diverse range of expert perspectives. Patently-O stands out for its commitment to maintaining high-quality, accessible information that caters to both legal professionals and academics interested in the nuances of patent law.
Twitter Followers 16.4K Frequency 5 posts / week

28. Jurist RSS Feed

RSS Feed jurist.org/news/feed   Follow RSS Blog jurist.org
JURIST is a non-profit legal news service operated by law students, offering insightful coverage on the rule of law during crises. Founded by Bernard Hibbitts, a professor at the University of Pittsburgh School of Law, the platform provides well-documented legal news and analysis. Contributors include students from various law schools worldwide, under Hibbitts' editorial leadership, making JURIST a unique blend of educational initiative and professional news service. The blog's commitment to accuracy and comprehensiveness makes it a valuable resource for legal professionals and scholars.
Facebook Followers 17.4KInstagram Followers 1.7K Frequency 11 posts / day

29. Attorney at Work RSS Feed

RSS Feed attorneyatwork.com/feed   Follow RSS Blog attorneyatwork.com
Attorney at Work is a comprehensive resource for legal professionals, delivering daily tips and insights to help lawyers enhance their practice and career. Founded in 2011, the blog features contributions from hundreds of industry experts and thought leaders. The editorial team includes Joan Feldman, Editor-in-Chief, with over 30 years of experience in legal publications, and Mark Feldman, Publisher, an award-winning art director. Attorney at Work covers various topics such as marketing, technology, and law firm management, offering free guides, product reviews, and a popular daily newsletter.
Facebook Followers 2.3K Frequency 1 post / day

30. Law & Liberty RSS Feed

RSS Feed lawliberty.org/feed   Follow RSS Blog lawliberty.org
Law & Liberty is a distinguished online platform dedicated to exploring the classical liberal tradition of law and political thought, emphasizing a society of free and responsible individuals. Sponsored by Liberty Fund, Inc., the site features rigorous debate, commentary, essays, book reviews, and interviews. Law & Liberty aims to examine foundational legal principles and contemporary issues. Notable contributors include various scholars and legal experts, providing diverse perspectives on maintaining a free society.
Facebook Followers 46.6KTwitter Followers 8.1K Frequency 2 posts / day

31. Lawyer Monthly RSS Feed

RSS Feed lawyer-monthly.com/feed   Follow RSS Blog lawyer-monthly.com
Lawyer Monthly is a comprehensive news website and monthly publication dedicated to providing the latest significant legal news from around the globe. Covering key practice areas, jurisdictions, and sectors, the magazine offers insightful commentary on the current legal landscape. Utilizing a multi-platform approach, it delivers content through print and digital formats, including real-time online updates and social media. Lawyer Monthly aims to keep legal professionals informed and engaged with up-to-date news and expert analysis.
Facebook Followers 32KTwitter Followers 8.1KInstagram Followers 3K Frequency 8 posts / week

32. Lex Blog » Southern California Bankruptcy Law Blog RSS Feed

RSS Feed lexblog.com/feed   Follow RSS Blog lexblog.com
LexBlog is a pioneering platform founded by Kevin O'Keefe in 2004, dedicated to empowering legal professionals through blogging and digital publishing. Originating from Kevin's vision to help lawyers build their online presence, LexBlog now supports over 25,000 bloggers, including those from the top law firms in the U.S. The editorial team includes professionals like Brian Biddle, Creative Director, and Colin O'Keefe, Publisher. LexBlog not only provides technology solutions but also fosters a global community for legal insights and networking.
Facebook Followers 988Twitter Followers 18.1K Frequency 23 posts / day

33. Legal Reader RSS Feed

RSS Feed legalreader.com/feed   Follow RSS Blog legalreader.com
Legal Reader is a dedicated legal blog established in 2002, focused on protecting consumers and exposing corporate and organizational misconduct. Founded and edited by Jay W. Belle Isle, the site features content from staff writers Dawn Allen, Briana Smith, Sara E. Teller, and Ryan J. Farrick, as well as guest posts from experts in consumer safety. Legal Reader prides itself on clear, accessible commentary, free from corporate advertising influence, ensuring unbiased information aimed at highlighting issues where profit is prioritized over safety.
Facebook Followers 764Twitter Followers 652 Frequency 8 posts / day

34. Legal Desire RSS Feed

RSS Feed legaldesire.com/feed   Follow RSS Blog legaldesire.com
Legal Desire is a leading legal news and information platform that has been at the forefront of the legal media industry for over a decade. Founded by Abhyuday Agarwal, the blog aims to provide credible advice and comprehensive insights on various legal topics to a global audience. Covering a wide range of subjects, from business law and intellectual property to human rights and criminal law, Legal Desire is known for its in-depth analysis and objective reporting. The editorial team comprises experienced journalists and legal experts who strive to keep readers informed about the latest developments in the legal world. Legal Desire also offers additional resources such as expert opinions, interviews, and a variety of legal courses and podcasts, ensuring that both legal professionals and the general public have access to valuable information and tools to stay updated in the fast-paced legal landscape.
Facebook Followers 88.6KTwitter Followers 919Instagram Followers 2K Frequency 4 posts / day

35. LawFuel RSS Feed

RSS Feed lawfuel.com/feed   Follow RSS Blog lawfuel.com
LawFuel is a leading legal news blog that provides timely updates and in-depth analyses on various legal topics, catering to a global audience of legal professionals, students, and enthusiasts. Founded by John Bowie, LawFuel is renowned for its comprehensive coverage of the legal industry's latest developments, from high-profile cases to emerging trends in legal technology. The editorial team, including experienced legal journalists and contributors, ensures the content remains authoritative and engaging. LawFuel's commitment to delivering insightful commentary and up-to-date news makes it an essential resource for anyone interested in the legal field.
Facebook Followers 970Twitter Followers 2.3K Frequency 30 posts / month

36. Attorney at Law Magazine RSS Feed

More images RSS Feed attorneyatlawmagazine.com/feed   Follow RSS Blog attorneyatlawmagazine.com
Since 2007, Attorney at Law Magazine has been published in local markets nationwide. Today, its online presence has expanded it to be a publication for lawyers and legal professionals as well as a resource for legal consumers. Beyond sharing informative articles and trending op-eds, Attorney at Law Magazine also spotlights the standout lawyers in the industry. With over 10 million magazines printed, Attorney at Law Magazine has the power of a print and digital publication.
Facebook Followers 3.8KTwitter Followers 999Instagram Followers 2.6KLinkedIn Frequency 6 posts / day Get Contact

37. Asia Law Portal RSS Feed

RSS Feed asialawportal.com/feed   Follow RSS Blog asialawportal.com
Asia Law Portal is a leading blog that provides news, information, and insights on the legal markets across the Asia-Pacific region. Founded in 2013 following the Inter-Pacific Bar Association annual meeting in Seoul, the blog is modeled after the World Economic Forum's platforms. It features contributions from lawyers, legal professionals, and law students, covering topics such as legal innovation, key legal issues, and practice management.
Facebook Followers 3KTwitter Followers 19.4K Frequency 2 posts / week Since Jul 2020

38. Alqada RSS Feed

RSS Feed   Follow RSS Blog alqada.ae
blog post, articles related to law and regulations in Dubai, based on latest updates across UAE. Alqada is a Dubai-based legal claim collection agency that provides claims collection services to individuals and corporates.
Facebook Followers 154Instagram Followers 994 Frequency 10 posts / day

39. Harris Bricken China Law Blog RSS Feed

RSS Feed chinalawblog.com/feed   Follow RSS Blog harrisbricken.com
A blog all about the business of China law & the law of China business. You'll get to learn how Chinese laws impact businesses in China. Harris Bricken is a boutique international law firm, offers specialized legal assistance to businesses that operate internationally.
Facebook Followers 24KTwitter Followers 848 Frequency 1 post / day Since Jan 2006

40. Technology & Marketing Law RSS Feed

RSS Feed blog.ericgoldman.org/feed   Follow RSS Blog blog.ericgoldman.org
The Technology & Marketing Law Blog, authored by Eric Goldman, is a comprehensive resource focusing on Internet law, intellectual property, and advertising law. Goldman, a professor at Santa Clara University School of Law and co-director of its High Tech Law Institute, has been blogging since 2005. His blog is recognized for its thorough analysis and updates on legal issues, including Section 230 of the Communications Decency Act. Goldman's work is highly regarded, frequently cited in court opinions, and he has been named an 'IP Vanguard' by the California State Bar.
Twitter Followers 14.7K Frequency 1 post / day Since Feb 2005

41. Artificial Lawyer RSS Feed

RSS Feed artificiallawyer.com/feed   Follow RSS Blog artificiallawyer.com
Artificial Lawyer is a dynamic blog dedicated to exploring the intersection of legal practice and cutting-edge technology. Founded by Richard Tromans, the platform delves into the transformative potential of AI, automation, and innovative business models within the legal sector. Tromans, an expert in legal innovation, has built a reputation for insightful commentary and thorough analysis. The blog's editorial team includes contributors who are equally passionate about the future of law and technology, making Artificial Lawyer a key resource for professionals keen on legal tech advancements.
Twitter Followers 11.7K Frequency 1 post / month

42. LexForti Legal News & Journal RSS Feed

RSS Feed lexforti.com/legal-news/feed   Follow RSS Blog lexforti.com
Offers access to a wide array of legal knowledge through the Daily Legal News segment of our Website. LexForti Legal News & Journal contains a vast assortment of resources that helps in understanding contemporary legal issues.
Facebook Followers 2.4KInstagram Followers 8.5K Frequency 1 post / quarter

43. Law In Sport RSS Feed

RSS Feed lawinsport.com/feed/rss/arti..   Follow RSS Blog lawinsport.com
LawInSport is a premier platform dedicated to sports law, providing expert analysis and commentary on legal developments in the sports industry. Founded in 2010 by Sean Cottrell, it serves a global community of over 30,000 members, including lawyers, sports executives, athletes, and academics. The blog features contributions from a distinguished editorial board of over 90 experts from more than 20 countries, ensuring high-quality, peer-reviewed content. LawInSport also offers a variety of resources such as articles, podcasts, videos, and professional courses to enhance knowledge and governance in sports law.
Facebook Followers 1.7KTwitter Followers 17.5K Frequency 1 post / week

44. Intelligize Blog RSS Feed

RSS Feed intelligize.com/blog/feed   Follow RSS Blog intelligize.com
Covers a range of topics including Accounting, ESG, Investor Relations, IPO, M&A, News, Risk Factors, Rules & Regs, and SEC. Stay up to date with news & information from Intelligize, the leading provider in regulatory insights & tools for compliance.
Twitter Followers 437 Frequency 1 post / week Since Jan 2017

45. Michigan Auto Law RSS Feed

RSS Feed michiganautolaw.com/feed   Follow RSS Blog michiganautolaw.com
A blog covering updates on changes in the auto law of the state. Articles are in the categories of Injuries, News, Car Insurance, Auto Safety, Attorney Resources, and Accidents. Michigan Auto Law helps people injured in car, truck, and motorcycle accidents throughout the state.
Facebook Followers 6KTwitter Followers 2.3KInstagram Followers 383 Frequency 13 posts / quarter

46. European Law Blog RSS Feed

RSS Feed europeanlawblog.eu/feed   Follow RSS Blog europeanlawblog.eu
The European Law Blog provides expert analysis and commentary on current developments in EU law, authored by a diverse group of academics and practitioners. The blog, known for its concise and accessible style, covers a wide range of legal topics, including case law, legislation, and scholarly debates. Key contributors include Dr. Laurens Ankersmit, Dr. Maria Haag, Jasmin Hiry, Katie Nolan, and Marine Corhay, each bringing specialized knowledge in various aspects of EU law.
Twitter Followers 6.2K Frequency 2 posts / week Since Jan 2012

47. Lowering the Bar RSS Feed

RSS Feed loweringthebar.net/feed   Follow RSS Blog loweringthebar.net
Lowering the Bar is a unique legal humor blog authored by Kevin Underhill, a partner at Shook, Hardy & Bacon's San Francisco office. Underhill, known for his witty and analytical writing, launched the blog in 2005 to highlight the oddities and humorous aspects of the legal world. The blog features a wide range of topics, from bizarre lawsuits to strange legal precedents, all presented with a sharp comedic touch. Underhill's work has been featured in prestigious outlets like the Wall Street Journal and National Public Radio, showcasing his knack for blending humor with legal insight.
Frequency 1 post / week

48. Davidson & Co Legal Consultants RSS Feed

RSS Feed davidsoncolaw.com/feed   Follow RSS Blog davidsoncolaw.com
Blog posts cover Legal Updates, Corporate/Commercial, Employment, Economy, Federal Law, Dispute Resolution, Banking & Finance, and Davidson & Co Updates. Davidson & Co is a boutique law firm with offices in Dubai and Geneva, specializing in providing uniquely commercial legal advice.
Facebook Followers 198Twitter Followers 985 Frequency 1 post / week

49. Nonprofit Law Blog RSS Feed

RSS Feed   Follow RSS Blog nonprofitlawblog.com
Nonprofit Law Blog is a specialized resource managed by Gene Takagi, the managing attorney of NEO Law Group, and offers valuable insights into legal matters affecting nonprofit organizations. Since its inception, the blog has been a go-to source for nonprofit professionals, providing expert analysis on corporate, tax, and charitable trust laws. Contributors to the blog include Erin Bradrick, Senior Counsel at NEO Law Group, and Michele Berger, a nonprofit attorney. The blog covers a wide range of topics, from governance and compliance to fundraising and social enterprise.
Frequency 2 posts / week

50. KJK RSS Feed

RSS Feed kjk.com/feed   Follow RSS Blog kjk.com
Covers news related general to all businesses such as Corporate Law, Labor & Employment and Tax Law, and has categories tailored to specific industries, such as Esports & Entertainment, Construction & Trades, Real Estate, Health Care and more. KJK is an Ohio law firm serving businesses nationwide.
Facebook Followers 344Twitter Followers 219 Frequency 2 posts / week

51. Broadcast Law Blog RSS Feed

RSS Feed broadcastlawblog.com/feed   Follow RSS Blog broadcastlawblog.com
Broadcast Law Blog is a comprehensive resource managed by David Oxenford, a partner at Wilkinson Barker Knauer LLP. The blog provides insights into various legal issues pertinent to radio and television broadcasters, including FCC regulations, copyright, advertising, and digital media concerns. With over 30 years of experience, Oxenford represents a diverse clientele ranging from small family-owned stations to large noncommercial radio networks. He frequently speaks at industry conferences and offers expert commentary on broadcasting and music licensing issues.
Twitter Followers 1.1K Frequency 1 post / week

52. My Shingle RSS Feed

RSS Feed feeds.feedburner.com/MyShingle1   Follow RSS Blog myshingle.com
MyShingle is a pioneering blog founded in 2002 by Carolyn Elefant, dedicated to empowering solo and small law firm practitioners. With a wealth of resources including blog posts, e-books, and checklists, MyShingle provides practical guidance for lawyers looking to start or enhance their own practices. Carolyn Elefant, an accomplished attorney and author, is recognized as an ABA Legal Rebel and an advocate for small firms leveraging technology to compete with larger firms. Her work has significantly influenced the legal community, offering innovative solutions and support for solo practitioners.
Twitter Followers 13.8K Frequency 1 post / week

53. Diamond and Diamond Lawyers Blog RSS Feed

RSS Feed diamondlaw.ca/feed   Follow RSS Blog diamondlaw.ca
Diamond and Diamond Lawyers is a personal injury law firm founded in 2005 in Ontario, Canada. The firm's mission is to provide compassionate and effective legal support for their clients and to ensure they receive fair compensation for their losses. The Diamond and Diamond Lawyers Blog offers helpful tips and resources.
Facebook Followers 4.3K Frequency 2 posts / month

54. Center For Art Law RSS Feed

RSS Feed itsartlaw.org/feed   Follow RSS Blog itsartlaw.org
The Center for Art Law is a nonprofit organization that conducts research and offers resources & programming for the advancement of a vibrant arts & law community. Here, you'll get articles on Art Law, Book Reviews, Case Reviews, and Cultural Heritage.
Facebook Followers 2.3KTwitter Followers 3.2KInstagram Followers 4.4K Frequency 3 posts / month Since Apr 2013

55. BeSpacific RSS Feed

RSS Feed bespacific.com/feed   Follow RSS Blog bespacific.com
BeSpacific is a renowned blog offering focused research on law, technology, and knowledge discovery since 2002. Founded and managed by Sabrina I. Pacifici, a distinguished law librarian, editor, and publisher, the blog covers a wide array of topics including cybersecurity, civil liberties, government regulation, and intellectual property. Sabrina is also the creator of LLRX.com, a legal and technology research resource established in 1996. BeSpacific has received multiple accolades, such as the Expert Institute Award for Best Legal Tech Blog and recognition from the American Bar Association as one of the top 100 law blogs.
Facebook Followers 187 Frequency 4 posts / day

56. The Court RSS Feed

RSS Feed thecourt.ca/feed   Follow RSS Blog thecourt.ca
An online resource for debate & data about the Supreme Court of Canada. The goal is to be an inclusive forum for academics, practitioners, and interested citizens to publish, review & discuss commentary on recent Supreme Court judgments, upcoming cases, current hearings, scholarly perspectives, practical insights, updates, and more.
Facebook Followers 1.1KTwitter Followers 5.8K Frequency 1 post / week Since Jan 2007

57. :: Ghana Law Hub RSS Feed

RSS Feed ghanalawhub.com/feed   Follow RSS Blog ghanalawhub.com
Ghana Law Hub exists to create and encourage the creation of timely, relevant and authentic Ghanaian legal resources. To this end, the Hub aims at detailing key and major events and developments in the legal arena from as many perspectives as possible.
Facebook Followers 10.6K Frequency 2 posts / month Since Apr 2017

58. Patrick Daniel Law RSS Feed

RSS Feed patrickdaniellaw.com/feed   Follow RSS Blog patrickdaniellaw.com
Patrick Daniel Law is based in Houston, TX and has experience in Agricultural Injury, Maritime Law, Medical Malpractice, Defective Product Lawsuits, Automobile and Trucking Accident Litigation and Various other types of personal injury actions.
Facebook Followers 827Twitter Followers 3KInstagram Followers 19.7K Frequency 1 post / day

59. Probate Stars RSS Feed

RSS Feed probatestars.com/feed   Follow RSS Blog probatestars.com
Probate Stars is the most comprehensive collection of information about probate, trusts, estate planning, guardianships, and inheritance litigation on the web. We provide a platform to connect people with legal problems with qualified lawyers in their region.
Facebook Followers 35 Frequency 5 posts / week

60. KnowLaw RSS Feed

RSS Feed knowlaw.in/index.php/feed   Follow RSS Blog knowlaw.in
KnowLaw stands as a pioneering educational platform, dedicated to serving law aspirants, students, and mentors. Its unwavering mission revolves around providing accessible and engaging resources, enhancing the legal education experience for everyone in the legal fraternity.
Facebook Followers 108Instagram Followers 2.1K Frequency 1 post / month Since Feb 2020

61. Frost Law News RSS Feed

RSS Feed   Follow RSS Blog askfrost.com
Articles feature insights and tips for Tax Law, Business Law, Bankruptcy Law & Estate Law trends. Frost & Associates, LLC is comprised of dedicated tax attorneys and other tax professionals navigating the toughest international and domestic tax issues.
Facebook Followers 1.5K Frequency 3 posts / week

62. The Malaysian Lawyer RSS Feed

RSS Feed themalaysianlawyer.com/feed   Follow RSS Blog themalaysianlawyer.com
The Malaysian Lawyer is a collaborative blog by two lawyers, Lee Shih & Marcus van Geyzel. We set out updates on certain areas of Malaysian law. Key topics covered are company law, corporate rescue, insolvency, judicial management, restructuring, and more.
Frequency 2 posts / quarter Since Oct 2015

63. Kluwer Competition Law Blog RSS Feed

RSS Feed feeds.feedburner.com/Kluw..   Follow RSS Blog competitionlawblog.kluwercompetitionlaw.com
The Kluwer Competition Law Blog is a leading platform for insights and updates on international competition and antitrust law, featuring contributions from a distinguished group of legal experts, including practicing lawyers, academics, and economists. The blog is managed by an editorial team comprising Peter Citron, Lena Hornkohl, and Alba Ribera Martínez, among others. It covers significant cases, policy developments, and legislative changes, offering timely and high-quality analysis to its readers.
Facebook Followers 32.3KTwitter Followers 17K Frequency 4 posts / week

64. Parker Poe RSS Feed

RSS Feed   Follow RSS Blog parkerpoe.com
Stay up on Parker Poe's latest news & insights, client alerts, outside publications, and media mentions. Parker Poe represents Southeast's largest companies and local governments in transactions, regulatory issues, and complex litigation.
Facebook Followers 745Twitter Followers 1.2K Frequency 16 posts / month

65. Vanguard Law Magazine RSS Feed

RSS Feed   Follow RSS Blog vanguardlawmag.com
Vanguard is a digital publication that showcases the incredible diversity of the modern in-house counsel, highlighting the philosophies, strategies, and initiatives of attorneys from around the world. Vanguard takes a deep dive into these complex and ever-evolving roles, giving you, the reader, an inside look at how some of the world's biggest companies navigate shifting legal terrain.
Facebook Followers 359 Frequency 3 posts / month

66. ACC Docket RSS Feed

RSS Feed   Follow RSS Blog accdocket.com
The award-winning ACC Docket features articles written by in-house counsel, for in-house counsel. Articles cover Compliance & Ethics, Diversity & Inclusion, Information Governance, Environmental, Dispute Resolution, and Law Dept Management.
Facebook Followers 5.1KTwitter Followers 1.7K Frequency 7 posts / month

67. IRS Streamlined Filing Compliance Blog RSS Feed

RSS Feed irsstreamlinedprocedures.com..   Follow RSS Blog irsstreamlinedprocedures.com
An International Tax Blog featuring the latest articles, news & updates. We are International Tax Lawyers for Taxpayers worldwide.
Frequency 2 posts / month

68. Constitutional Law Reporter RSS Feed

RSS Feed constitutionallawreporter.co..   Follow RSS Blog constitutionallawreporter.com
The Constitutional Law Reporter is an authoritative blog that delves into key issues and developments in U.S. constitutional law. Managed by Donald Scarinci, a seasoned constitutional law attorney and managing partner at Scarinci Hollenbeck, the blog offers in-depth analyses of Supreme Court cases, constitutional amendments, and historical legal milestones. Scarinci, a well-respected legal expert, frequently updates the blog with insightful commentary, making it a valuable resource for legal professionals, scholars, and anyone interested in constitutional law.
Facebook Followers 1.9KTwitter Followers 7.5K Frequency 1 post / month

69. Canadian Labour and Employment Law RSS Feed

RSS Feed labourandemploymentlaw.com/feed   Follow RSS Blog labourandemploymentlaw.com
Baker & McKenzie's Canadian Labour and Employment Law blog provides employers with up to date information on legal developments that impact workplace policies and procedures, human resources management, employment agreements, discipline and dismissal, and employment-related litigation.
Facebook Followers 23.9K Frequency 1 post / week

70. The Sam Bernstein Law Firm RSS Feed

RSS Feed callsam.com/feed   Follow RSS Blog callsam.com/blog
Blog features Articles on Vehicle Accidents, Serious Injuries, Medical Issues, and more. The Sam Bernstein Law Firm is a personal injury law firm that provides legal help to accident victims across the state of Michigan.
Facebook Followers 35KTwitter Followers 1.2K Frequency 9 posts / quarter

71. Legal Mosaic RSS Feed

RSS Feed legalmosaic.com/feed   Follow RSS Blog legalmosaic.com
Legal Mosaic, founded by Mark A. Cohen, is a blog dedicated to modernizing the legal industry through thought leadership, consulting, and educational content. Cohen, an influential figure in legal innovation, has a diverse background as a former Assistant U.S. Attorney, BigLaw partner, and founder of legal enterprises like Clearspire. The blog features insights on the intersection of law, business, and technology, aiming to enhance legal service delivery and integrate legal functions with business needs.
Frequency 5 posts / year

72. TechnoLlama RSS Feed

RSS Feed feeds2.feedburner.com/Techno..   Follow RSS Blog technollama.co.uk
TechnoLlama is a blog managed by Dr. Andrés Guadamuz, a Senior Lecturer in Intellectual Property Law at the University of Sussex. The blog delves into various cyberlaw topics with a focus on artificial intelligence, internet regulation, and cryptocurrencies, often presenting complex issues in an approachable, light-hearted manner. Dr. Guadamuz is known for his engaging writing style and his expertise in the intersection of technology and law. TechnoLlama has garnered a dedicated readership for its insightful and accessible commentary on contemporary legal issues in the digital realm.
Facebook Followers 328Twitter Followers 7KInstagram Followers 341 Frequency 1 post / month

73. Sandberg Phoenix | Employer Law Blog RSS Feed

RSS Feed sandbergphoenix.com/perspect..   Follow RSS Blog sandbergphoenix.com
Employer Law Blog has been helping business people navigate employment law. Recognizing that every business with employees faces challenges that can impact their growth and profitability, Sandberg Phoenix attorneys are committed to sharing their knowledge of, experience with and passion for employment law.
Facebook Followers 628Twitter Followers 311 Frequency 1 post / week

74. Seyfarth | California Peculiarities Employment Law Blog RSS Feed

RSS Feed calpeculiarities.com/feed   Follow RSS Blog calpeculiarities.com
California Peculiarities Employment Law Blog covers legislative updates & commentary on employer laws in CA including harassment & wage statements. The Seyfarth California Peculiarities Employment Law Blog is a unique - and peculiarities - of California employment law. This blog is for in-house attorneys, HR professionals, business owners, and managers who face real issues on a daily basis and need practical solutions to address them.
Facebook Followers 990Twitter Followers 10K Frequency 1 post / month

75. DRDN Law RSS Feed

RSS Feed drdn-law.com/feed   Follow RSS Blog drdn-law.com
DRDN Law is a law blog that covers topics including, attorney, bankruptcy, divorce, law, lawyer, legal service, personal injury and more.
Frequency 1 post / week

76. Simple Justice RSS Feed

RSS Feed blog.simplejustice.us/feed   Follow RSS Blog blog.simplejustice.us
Simple Justice is a well-regarded blog managed by Scott H. Greenfield, a seasoned criminal defense attorney. The blog offers insightful commentary on legal issues, criminal justice reform, and broader societal matters. Greenfield, who practices law in New York, uses his platform to critique the legal system and advocate for justice and fairness. His writing is known for its candid and often provocative style, engaging readers in deep discussions about law and ethics. The blog includes contributions from various legal experts and commentators who provide diverse perspectives on contemporary legal issues. Simple Justice is also noted for its active and thoughtful comment section, where readers engage in robust debates. Over the years, Greenfield's blog has become a key resource for legal professionals and anyone interested in the intersection of law and society.
Twitter Followers 18.9K Frequency 1 post / day

77. Acumen Law Corporation RSS Feed

RSS Feed vancouvercriminallaw.com/fee..   Follow RSS Blog vancouvercriminallaw.com
Blog of Acumen Law Corporation dealing mainly with IRP DUI law & developments in drunk driving law. Acumen Law Corporation is a Vancouver Criminal Law Firm that helps people who are facing criminal charges, DUI or driving prohibitions in British Columbia, Canada.
Facebook Followers 1.3KTwitter Followers 3K Frequency 1 post / week

78. Cohn Legal, PLLC RSS Feed

RSS Feed cohnlg.com/feed   Follow RSS Blog cohnlg.com
Our goal is to provide our clients with exceptional legal guidance and support at cost-effective rates. While excellence in legal representation is a given, we take greater pride in our ability to forge lasting bonds with our clients.
Frequency 1 post / week

79. Talk Left RSS Feed

RSS Feed talkleft.com/index.xml   Follow RSS Blog talkleft.com
TalkLeft, founded by criminal defense attorney Jeralyn Merritt in 2000, is a liberal blog focused on crime-related political news and justice issues. Merritt, who has extensive legal experience, has covered notable trials and collaborated with prominent legal commentators. The blog has received multiple awards and has been featured in Newsweek Online, offering in-depth analysis and commentary on criminal justice topics.
Facebook Followers 760Twitter Followers 823 Frequency 1 post / week

80. SeiferFlatow RSS Feed

RSS Feed seiferflatowlaw.com/feed   Follow RSS Blog seiferflatowlaw.com
Keep up with articles from SeiferFlatow.
Twitter Followers 662Instagram Followers 437 Frequency 1 post / month

81. iPhone J.D. RSS Feed

RSS Feed iphonejd.com/iphone_jd/index..   Follow RSS Blog iphonejd.com
iPhone J.D. is the oldest and largest website for lawyers using iPhones and iPads. Published by Jeff Richardson, an attorney in New Orleans, Louisiana.
Twitter Followers 2.2K Frequency 3 posts / week

82. FizzLaw.com RSS Feed

RSS Feed fizzlaw.com/news/feed   Follow RSS Blog fizzlaw.com/news
FizzLaw is an attorney blog (blawg) platform that enables lawyers & legal professionals to publish legal content. Our lawyer guest blogging platform is incredibly easy to manage and intuitive, making it easy to publish a legal article on topics that are relevant to your practice.
Frequency 2 posts / week

83. Legal Planet RSS Feed

RSS Feed legal-planet.org/feed   Follow RSS Blog legal-planet.org
Legal Planet provides insight and analysis on energy and environmental law. Our goal is to fill a unique space in the blogosphere. We write about court decisions, regulatory actions, and state and legislation that affect climate change policy, water resource management, toxic waste disposal, renewable energy, air quality, land use, and more.
Twitter Followers 2.1K Frequency 1 post / day Since Jan 2009

84. BC Injury Law and ICBC Claims Blog RSS Feed

RSS Feed feeds.feedburner.com/IcbcLaw   Follow RSS Blog bc-injury-law.com
BC Injury Law is a blog managed by Erik Magraken, a personal injury lawyer at the MacIsaac Group of Law Firms. The blog provides detailed legal insights and updates on personal injury law in British Columbia, focusing on topics such as ICBC claims, negligence, and the application of various legal principles in injury cases. With a commitment to educating the public and other legal professionals, BC Injury Law covers a wide range of issues, including the nuances of motor vehicle accident claims, the impact of new legislation, and significant court rulings.
Facebook Followers 170Twitter Followers 6K Frequency 3 posts / month

85. Futeral & Nelson LLC RSS Feed

RSS Feed charlestonlaw.net/feed   Follow RSS Blog charlestonlaw.net
The Charleston Law Blog, managed by the Futeral & Nelson law firm, offers a wealth of information on various legal topics pertinent to South Carolina, including DUI laws, defamation, family law, and more. The blog is authored primarily by Stephan Futeral, a seasoned attorney with extensive experience in family law, criminal defense, and personal injury cases. The blog aims to provide clear, practical legal advice and updates, making it a valuable resource for residents seeking to understand their legal rights and responsibilities.
Facebook Followers 1.7KTwitter Followers 1.1K Frequency 1 post / week

86. Gravel2Gavel Construction Law Blog RSS Feed

RSS Feed gravel2gavel.com/feed   Follow RSS Blog gravel2gavel.com
Gravel2Gavel is a comprehensive blog that delves into the complexities of construction and real estate law, published by the attorneys at Pillsbury Winthrop Shaw Pittman LLP. The blog provides detailed insights on a wide array of topics, including environmental regulations, real estate transactions, and construction industry trends. With contributions from an experienced editorial team, such as Emily Bias, Editor-in-Chief, and legal experts like Stephan E. Becker and Julia Kalinina Belcher, Gravel2Gavel is a valuable resource for professionals navigating the legal landscape of construction and real estate.
Twitter Followers 2.5K Frequency 1 post / week

87. Kean Miller LLP Blog RSS Feed

RSS Feed louisianalawblog.com/feed   Follow RSS Blog louisianalawblog.com
Insight and Information on Louisiana law, litigation, and legal culture. Kean Miller LLP serves as legal counsel to the people and industries that drive the regional economy and provide efficient and effective legal services in a cost-efficient manner.
Facebook Followers 1.3KTwitter Followers 400 Frequency 2 posts / month

88. UK Constitutional Law Association RSS Feed

RSS Feed ukconstitutionallaw.org/feed   Follow RSS Blog ukconstitutionallaw.org
The UK Constitutional Law Association (UKCLA) blog is a platform dedicated to the discussion and promotion of knowledge regarding UK constitutional law and comparative constitutional law. Established in 2003 and formalized in 2014, the UKCLA organizes seminars and supports academic research through its blog, which attracts a broad readership. The current president is Sebastian Payne from the University of Kent, and the association boasts a distinguished executive committee of constitutional law scholars. The blog is supported by The Constitution Society and provides in-depth analysis and commentary on constitutional issues.
Twitter Followers 6.6K Frequency 1 post / week

89. Foley Hoag | Trademark & Copyright Law RSS Feed

RSS Feed trademarkandcopyrightlawblog..   Follow RSS Blog trademarkandcopyrightlawblog.com
Perspectives & Legal developments in Trademarks, Copyrights, Domain Disputes, Unfair Competition, and more. Some sub-topics cover Criminal Liability, Defamation, Right of Publicity, Privacy, and Licensing. Authored by Lawyers of Foley Hoag Law Firm.
Facebook Followers 798Twitter Followers 3.3K Frequency 1 post / month Since Mar 2010

90. Minick Law Blog RSS Feed

RSS Feed minicklaw.com/feed   Follow RSS Blog minicklaw.com
Minick Law's Legal Blog attempts to address common questions, to help you in your search for answers and general information about the legal process.
Facebook Followers 160Twitter Followers 35 Frequency 1 post / week

91. Global IP & Privacy Law RSS Feed

RSS Feed iptechblog.com/feed   Follow RSS Blog iptechblog.com
The Global IP & Technology Law Blog, hosted by Squire Patton Boggs, provides comprehensive coverage of significant developments in intellectual property and IT law. Edited by Tamara Fraizer, Simon Jones, and Joseph Grasser, the blog features insights on trademark protection, patent prosecution, trade secrets, data protection, privacy, and media issues. It serves as a crucial resource for businesses navigating the global economy's legal landscape, offering up-to-date news and expert analysis.
Facebook Followers 3.2KTwitter Followers 11.8KInstagram Followers 3.2K Frequency 1 post / week Since Oct 2013

92. Top Legal Firm RSS Feed

RSS Feed toplegalfirm.org/feed   Follow RSS Blog toplegalfirm.org
Top Legal Firm is a comprehensive blog offering valuable legal insights and practical advice across various fields of law, including personal injury, criminal defense, family law, and more. The blog is managed by a team of experienced legal professionals who provide up-to-date information on recent legal developments, case studies, and legal strategies. Key contributors include Brandon Price and other legal experts who share their knowledge to help readers understand and navigate complex legal issues.
Frequency 1 post / week Since Jul 2020

93. The Sheppard Mullin Labor & Employment Law Blog RSS Feed

RSS Feed feeds.lexblog.com/laboremplo..   Follow RSS Blog laboremploymentlawblog.com
The Sheppard Mullin Labor & Employment Law Blog is designed to provide employers breaking news, insights & legal analysis on issues facing employers today. Key topics covered are Antitrust, Cannabis Law, Corporate Governance, Employee Benefits, FEHA, Immigration, Retaliation, and Workers Compensation.
Facebook Followers 1.4KTwitter Followers 3.6K Frequency 1 post / week

94. Bressler Risk Blog RSS Feed

RSS Feed bresslerriskblog.com/feed   Follow RSS Blog bresslerriskblog.com
Focusing on law firm risk management: trends, challenges, conflicts, compliance, technology, information security, ethics & more.
Twitter Followers 34 Frequency 1 post / day

95. JCA Law Office | Immigration & Family Law RSS Feed

RSS Feed filipinolawyer.ca/feed   Follow RSS Blog filipinolawyer.ca
JCA Law Office provides assistance on Filipino Immigration, Real Estate Closings, NBI Clearance, NSO certificates, and other legal services.
Facebook Followers 8.1KTwitter Followers 40 Frequency 1 post / day

96. Customs & International Trade Law Blog RSS Feed

RSS Feed customsandinternationaltrade..   Follow RSS Blog customsandinternationaltradelaw.com
Customs & International Trade Law Blog, managed by Diaz Trade Law, provides valuable insights into the complex world of customs and international trade laws. Authored by Jennifer Diaz, a board-certified international attorney and president of Diaz Trade Law, the blog covers topics such as U.S. customs regulations, trade compliance, and import/export controls. The editorial team includes experienced legal professionals who regularly engage with federal agencies to help clients navigate legal challenges and remain competitive in the marketplace.
Facebook Followers 995Twitter Followers 778Instagram Followers 307 Frequency 1 post / week

97. Leading As Lawyers RSS Feed

RSS Feed leadingaslawyers.blog/feed   Follow RSS Blog leadingaslawyers.blog
A Place for the Discussion of Leadership and Leadership Development for Lawyers, Law Students and Legal Educators
Frequency 3 posts / month

98. Seyfarth | Workplace Class Action Blog RSS Feed

RSS Feed workplaceclassaction.com/feed   Follow RSS Blog workplaceclassaction.com
Workplace Class Action Blog is devoted to the needs of corporate employers confronting the challenges of complex workplace litigation. Our team of bloggers at Seyfarth are complex workplace litigation practitioners who provide advisory, litigation, and transactional legal services.
Facebook Followers 981Twitter Followers 1.2K Frequency 2 posts / week

99. The McKinney Law Firm RSS Feed

RSS Feed themckinneylawfirm.com/texas..   Follow RSS Blog themckinneylawfirm.com
Covers issues and developments in federal and Texas employment law, including wrongful termination, sexual harassment, discrimination, and retaliation news and cases. McKinney Law Firm is a firm that focuses on the most serious Employment Rights & Workplace Injury cases.
Twitter Followers 2.8K Frequency 1 post / month

100. The Last Word RSS Feed

RSS Feed rudrajyotinathray.com/feed   Follow RSS Blog rudrajyotinathray.com
The Last Word' seeks to include not only wise and witty sayings of the judges but also curiosities of lawyers and the law. This blog is not of obligation but of delight. I frankly confess my ignorance of much that ought to be included from overseas jurisdictions, and I utter a gentle prayer that those who know better would lighten my darkness.
Frequency 1 post / week Since Dec 2014

101. The Law Offices of Gary I. Handin RSS Feed

RSS Feed handinlaw.com/feed   Follow RSS Blog handinlaw.com
Gary I. Handin, PA., is dedicated to providing exceptional legal representation to each and every client we serve. Our success has been directly linked to our proven ability to provide professional, personalized and compassionate service. Get updated on your legal knowledge with the Gary I. Handin, P.A. legal updates and news page and articles.
Frequency 2 posts / quarter

102. Koehler Law Blog RSS Feed

RSS Feed koehlerlaw.net/feed   Follow RSS Blog koehlerlaw.net
Koehler Law defends people charged with criminal offenses in D.C., Arlington, and Alexandria. On the blog, author and attorney, Jamison Koehler shares stories and experiences as a Criminal lawyer. He also talks about current legal issues and high-profile public cases and engages readers in playful, entertaining yet informative ways.
Facebook Followers 91Twitter Followers 1.4K Frequency 5 posts / quarter

103. Sim & Rahman RSS Feed

RSS Feed simrahman.com/feed   Follow RSS Blog simrahman.com
Sim & Rahman is a law firm in Setia Alam, Malaysia ready to serve you and provide legal advice to meet your legal needs.
Frequency 4 posts / quarter Since Oct 2020

104. Grits for Breakfast RSS Feed

RSS Feed gritsforbreakfast.blogspot.c..   Follow RSS Blog gritsforbreakfast.blogspot.com
Grits for Breakfast is a well-regarded blog focused on criminal justice issues in Texas, authored by Scott Henson. Henson, a seasoned advocate and expert in criminal justice reform, uses the blog to provide insightful analysis and commentary on various aspects of the criminal justice system, including prison conditions, police practices, and legislative developments. Since its inception, the blog has earned numerous accolades, such as the 2004 Koufax Award for Best Single Issue Blog and the 2009 Austin Chronicle 'Best of Austin' Award. Grits for Breakfast is celebrated for its thorough research, balanced perspectives, and impactful reporting, making it a go-to resource for those interested in Texas criminal justice reform.
Frequency 1 post / week

105. Healthcare Law Insights RSS Feed

RSS Feed healthcarelawinsights.com/feed   Follow RSS Blog healthcarelawinsights.com
The Healthcare Law Insights blog, managed by Husch Blackwell LLP, provides expert analysis on healthcare regulations, compliance, and industry trends. The blog features contributions from leading healthcare attorneys like Bruce Arnold, Curt Chase, and Cori Turner. These experts offer insights on a wide range of topics, including hospital-physician strategic alignment, healthcare joint ventures, and compliance with the Stark Law and Anti-Kickback Statute. The blog aims to help healthcare providers navigate the complex legal landscape and stay informed about critical legal issues.
Instagram Followers 2.5K Frequency 1 post / day

106. Joshua Wu Kai-Ming RSS Feed

RSS Feed joshuawu.my/feed   Follow RSS Blog joshuawu.my
Keep up with the articles on Law, Politics, Religion from Joshua Wu Kai-Ming.
Frequency 1 post / month

107. Law Truly RSS Feed

RSS Feed lawtruly.com/feed   Follow RSS Blog lawtruly.com
Law Truly is a website dedicated to providing quality legal information to legal practitioners and others. For Lawyers, law and law practice are constantly changing making it imperative for legal practitioners to keep up with the change.
Frequency 2 posts / quarter Since Dec 2019

108. Understanding The Americans with Disabilities Act (ADA) RSS Feed

RSS Feed understandingtheada.com/feed   Follow RSS Blog understandingtheada.com
ADA legal consultant William D. Goren provides consultation, legal research and writing and counsels on cases involving compliance with the Americans with Disabilities Act (ADA) and the Rehabilitation Act of 1973.
Frequency 1 post / week

109. The Texas Attorney RSS Feed

RSS Feed thetexasattorney.com/feed   Follow RSS Blog thetexasattorney.com
Covers articles related to personal injuries and accidents, criminal defense, bankruptcy, family law and divorce, employment and labor law, social security and disability, and estate planning. The Texas Attorney brings four decades of hands-on experience to clients facing a wide range of legal challenges.
Facebook Followers 2Twitter Followers 2.2KInstagram Followers 1.1K Frequency 1 post / week

110. Talkov Law RSS Feed

RSS Feed talkovlaw.com/feed   Follow RSS Blog talkovlaw.com
Talkov Law is dedicated to educating the public and keeping up with the latest legal developments through our blog. Our blog posts cover all of our practice areas, including real estate law, family law, bankruptcy law, business law, and trusts & probate law.
Facebook Followers 58Twitter Followers 19 Frequency 6 posts / month Since Mar 2010

111. Karl Bayer RSS Feed

RSS Feed disputingblog.com/feed   Follow RSS Blog disputingblog.com
Disputing is published by Karl Bayer, a dispute resolution expert based in Austin, Texas. Articles published on Disputing aim to provide original insight and commentary around issues related to arbitration, mediation, and the alternative dispute resolution industry.
Frequency 2 posts / quarter

112. Nomos | California Construction Law Blog RSS Feed

RSS Feed calconstructionlawblog.com/feed   Follow RSS Blog calconstructionlawblog.com
At Nomos LLP, we've published this blog to keep everyone informed of new developments in construction law. From contract formation to contract disputes, we have the knowledge, expertise and pragmatism to take you from groundbreaking to ribbon cutting. Here are featured articles exclusively on Construction Law.
Facebook Followers 206Twitter Followers 172 Frequency 1 post / week

113. Weintraub Tobin Blog RSS Feed

RSS Feed thelelawblog.com/feed   Follow RSS Blog thelelawblog.com
The Labor and Employment Law blog is written by the Employment Lawyers at Weintraub Tobin law firm and discusses labor and employment topics, issues, and legal news. Weintraub Tobin is an innovative provider of sophisticated legal services to businesses and business owners throughout California.
Facebook Followers 448Twitter Followers 416 Frequency 1 post / week

114. Lerners Personal Injury Law Firm RSS Feed

RSS Feed lernerspersonalinjury.ca/ins..   Follow RSS Blog lernerspersonalinjury.ca
Lerners Personal Injury Law Firm blog provides updated information about personal injury law in Toronto & London, Ontario.
Facebook Followers 1.8KTwitter Followers 1.8K Frequency 1 post / quarter

115. Law 4 Small Business RSS Feed

RSS Feed feeds.feedburner.com/L4SB   Follow RSS Blog l4sb.com/blog
The Law 4 Small Business (L4SB) blog is a valuable resource for entrepreneurs and small business owners, offering expert legal advice and practical tips on managing and protecting their businesses. The blog covers a wide range of topics, including business formation, intellectual property, contracts, and legal compliance, ensuring that readers stay informed about essential legal matters. Through its posts, L4SB aims to simplify complex legal issues and provide actionable insights for business success.
Facebook Followers 2KTwitter Followers 227 Frequency 1 post / week

116. Wise Law Blog RSS Feed

RSS Feed wiselaw.blogspot.com/feeds/p..   Follow RSS Blog wiselaw.blogspot.com
Legal headlines and opinions from Toronto employment lawyer, Garry J. Wise and the lawyers of Wise Law Office, Toronto, Ontario.
Facebook Followers 173Twitter Followers 2.5K Frequency 1 post / day Since Apr 2005

117. Fire Law Blog RSS Feed

RSS Feed firelawblog.com/feed   Follow RSS Blog firelawblog.com
Fire Law Blog, managed by Curt Varone, offers expert insights into legal issues affecting fire service and public safety. With over 45 years of fire service experience and 35 years as an attorney, Varone provides a unique perspective on cases involving firefighter rights, department regulations, and legal precedents shaping the fire industry. He has authored several books and is a contributing editor for Firehouse Magazine. The blog covers a wide range of topics, including employment law, constitutional issues, and safety regulations, making it an essential resource for fire service professionals.
Facebook Followers 8.1KTwitter Followers 1.5K Frequency 1 post / day

118. Stephens' Squibs RSS Feed

RSS Feed eddiestephens.com/feed   Follow RSS Blog eddiestephens.com
A short concise summary of all Florida Family Law cases from 2005 - 2018 by Board Certified Divorce Attorney Eddie Stephens and selected published essays.
Facebook Followers 697Twitter Followers 422Instagram Followers 464 Frequency 2 posts / week Since Dec 2005

119. Who Is My Employee? RSS Feed

RSS Feed whoismyemployee.com/feed   Follow RSS Blog whoismyemployee.com
On this website, we will explore the various legal standards used to determine Who Is My Employee? We will examine new developments, trends, changes in the law, strategies, tips, and whatever else comes to mind.
Twitter Followers 1.2K Frequency 1 post / week

120. Houston Tax Attorney Blog RSS Feed

RSS Feed irstaxtrouble.com/feed   Follow RSS Blog irstaxtrouble.com
We provide IRS audit and tax debt solutions for clients nationwide. This includes settling IRS tax debts and resolving unpaid tax liabilities. Our goal is to help reduce the time, confusion, and stress associated with federal and state tax matters.
Facebook Followers 930Twitter Followers 16 Frequency 1 post / week

121. McNees | Pennsylvania Labor & Employment Blog RSS Feed

RSS Feed palaborandemploymentblog.com..   Follow RSS Blog palaborandemploymentblog.com
The McNees Labor & Employment Blog seeks to provide employers with operations in Pennsylvania with the latest updates, analysis, and commentary on how the law impacts employers at the national, state, and local level. Their attorneys cover topics including employment litigation, wage & hour issues, unions, social media, discrimination & harassment, employee benefits, and affirmative action.
Facebook Followers 694Twitter Followers 909 Frequency 2 posts / month

122. Security, Privacy And The Law RSS Feed

RSS Feed securityprivacyandthelaw.com..   Follow RSS Blog securityprivacyandthelaw.com
Security, Privacy And The Law provides legal perspectives on the expanding universe of information security and privacy issues. Foley Hoag is a law firm that represents public and private clients in a wide range of disputes and transactions worldwide.
Facebook Followers 766Twitter Followers 3.6K Frequency 1 post / month Since Oct 2008

123. Stephen Legal RSS Feed

RSS Feed stephenlegal.ng/feed   Follow RSS Blog stephenlegal.ng
Stephen Legal is in the business of providing innovative legal insights and easy solution in this information age. It presents an online platform for people.
Facebook Followers 6KTwitter Followers 440 Frequency 1 post / quarter Since Oct 2016

124. Lawyer Issue RSS Feed

RSS Feed lawyerissue.com/feed   Follow RSS Blog lawyerissue.com
Lawyer Issue has a highly targeted international readership and is a great tool for global professionals. We aim to provide valued insight into the legal sector and shine a spotlight on many of the trending issues.
Twitter Followers 1.8K Frequency 30 posts / year

125. Five Minute Law RSS Feed

RSS Feed fiveminutelaw.com/feed   Follow RSS Blog fiveminutelaw.com
'Why do you write like you're running out of time?'
Facebook Followers 85Twitter Followers 3.7K Frequency 5 posts / year

126. A&L Goodbody LLP Blog RSS Feed

RSS Feed irelandip.com/feed   Follow RSS Blog techlaw.ie
Ireland IP & Technology Law Blog provides the information you need to know about Intellectual property & technology law in Ireland. A&L Goodbody is an Irish law firm providing expert legal advice across every aspect of business law.
Facebook Followers 2.9KTwitter Followers 5K Frequency 4 posts / quarter

127. Holzfaster, Cecil, McKnight & Mues, LPA Blog RSS Feed

RSS Feed hcmmlaw.com/blog/feed   Follow RSS Blog hcmmlaw.com/blog
The Ohio Family Law Blog, authored by Robert 'Chip' Mues of Holzfaster, Cecil, McKnight & Mues, LPA, provides valuable insights on family law and divorce issues for Ohio families. With over four decades of experience, Mues brings extensive expertise in domestic relations litigation. The blog features contributions from esteemed colleagues like Joseph E. Balmer, head of Probate and Estate Planning, and Gary M. Hruska, a highly ethical counselor. The blog also includes guest posts from experts like Donna F. Ferber and Dr. Karen Finn, enriching its content with diverse perspectives.
Facebook Followers 361Twitter Followers 6.4KInstagram Followers 75 Frequency 1 post / week

128. Employment & Labor Insider Blog RSS Feed

RSS Feed constangy.com/employment-lab..   Follow RSS Blog constangy.com
Employment & Labor Insider is a blog managed by Robin Shea, a partner at Constangy, Brooks, Smith & Prophete, LLP. The blog focuses on providing practical insights and updates on labor and employment law. With over 30 years of experience in employment litigation, Shea brings a wealth of knowledge on topics like discrimination, workplace policies, and compliance. The blog features contributions from a diverse editorial team, including experts like William A. 'Zan' Blue, Jr., and Obasi Bryant, making it a valuable resource for employers seeking to navigate complex legal landscapes.
Facebook Followers 598Twitter Followers 1.4K Frequency 1 post / week

129. The Korean Law Blog RSS Feed

RSS Feed thekoreanlawblog.com/feed/atom   Follow RSS Blog thekoreanlawblog.com
The Korean Law Blog, maintained by IPG Legal, offers comprehensive insights into Korean law, the legal system, and law firms in Korea. Authored by Sean Hayes, a notable figure as the first non-Korean attorney employed by the Korean court system, the blog delves into various legal topics ranging from corporate law to dispute resolution. Hayes, recognized as a Top 100 Lawyer, brings his extensive experience and candid approach to legal analysis, making the blog a valuable resource for legal professionals and international businesses.
Twitter Followers 664 Frequency 19 posts / quarter

130. Election Law Blog RSS Feed

RSS Feed electionlawblog.org/?feed=rss2   Follow RSS Blog electionlawblog.org
The Election Law Blog, authored by Richard L. Hasen, provides expert analysis and commentary on election law, campaign finance regulation, and related political issues. Hasen, a professor at UCLA School of Law and director of the Safeguarding Democracy Project, has built the blog into a key resource for legal scholars, practitioners, and the public since its inception. The blog also features contributions from distinguished legal professionals and academics, ensuring a diverse and informed perspective on pressing election law matters.
Facebook Followers 1.7KTwitter Followers 92.8K Frequency 10 posts / day Since Sep 2003

131. Employers' Lawyers Blog RSS Feed

RSS Feed employerslawyersblog.com/feed   Follow RSS Blog employerslawyersblog.com
The Employers' Lawyers Blog offers the latest legal news and commentary on issues affecting today's employers. Their Labor and Employment team posts best practice tips, checklists and updates designed to keep organizations of all sizes in compliance with federal and state employment laws.
Twitter Followers 1.8K Frequency 1 post / week

132. D.R. PATTI & ASSOCIATES RSS Feed

RSS Feed vegaspifirm.com/index.php/feed   Follow RSS Blog vegaspifirm.com
D.R. Patti & Associates are Las Vegas trial lawyers handling personal injury, medical malpractice, business, DUI, and civil rights cases.
Facebook Followers 480Twitter Followers 30 Frequency 1 post / quarter

133. Lester Aldridge Solicitors | Legal Advice and Law Firm RSS Feed

RSS Feed lesteraldridge.com/feed   Follow RSS Blog lesteraldridge.com
Lester Aldridge solicitors are a full service law firm with offices in Bournemouth, Southampton & London. Outstanding private & commercial legal advice. For Lester Aldridge news, developments and new legislation, our blog has everything you'll need to know to keep you up to date.
Facebook Followers 539Twitter Followers 1.6KInstagram Followers 1.3K Frequency 1 post / day

134. Cardozo Arts & Entertainment Law Journal RSS Feed

RSS Feed cardozoaelj.com/feed/?x=1   Follow RSS Blog cardozoaelj.com
The Cardozo Arts & Entertainment Law Journal (AELJ) blog, hosted by the Benjamin N. Cardozo School of Law, offers in-depth analyses on arts, entertainment, intellectual property, First Amendment, sports, fashion, cyberlaw, and media and telecommunications law. Established in 1982, AELJ is recognized for its scholarly impact both nationally and internationally. The journal is edited by a team of dedicated law students and regularly publishes articles, hosts symposia, and collaborates with organizations like the GRAMMY Foundation.
Facebook Followers 511Twitter Followers 919 Frequency 7 posts / quarter

135. Eloise Gratton | Privacy & IT Law RSS Feed

RSS Feed eloisegratton.com/feed   Follow RSS Blog eloisegratton.com
Eloise Gratton is a lawyer practicing in Privacy and IT Law. She also teaches at the Faculty of Law, University of Montreal. She is a partner at Borden Ladner Gervais LLP and National Co-Leader of the Privacy and Data Security Practice Group. She shares the latest news and updates about Privacy and IT law on her blog.
Twitter Followers 2.6K Frequency 3 posts / quarter

136. LegalDocsA2Z RSS Feed

RSS Feed legaldocsa2z.com/feed   Follow RSS Blog legaldocsa2z.com
Orange County Divorce Attorney |LegalDocsA2Z encourages Amicable divorce flat fee $599 with kids, $499 no kids, save your money and time
Facebook Followers 1.4KInstagram Followers 33 Frequency 7 posts / year

137. Inpractice | Business Development and Legal Technology for Law Firms RSS Feed

RSS Feed inpractice.co.uk/feed/rss2   Follow RSS Blog inpractice.co.uk
Enabling lawyers to plan ahead to build a smarter business that stands out. Effective, innovative and competitive.
Twitter Followers 1.1K Frequency 3 posts / year

138. ONE400 RSS Feed

RSS Feed one-400.com/feed   Follow RSS Blog one-400.com/blog
ONE400 is a law innovation agency focusing on cutting edge websites and integrated marketing solutions for law firms and legal tech startups.
Facebook Followers 557Twitter Followers 2.8KInstagram Followers 360 Frequency 1 post / week

139. Labour Pains RSS Feed

RSS Feed ottawaemploymentlaw.com/feed..   Follow RSS Blog ottawaemploymentlaw.com
An employment law blog for employers and employees. Published by Sean Bawden of Kelly Santini LLP. Sean P. Bawden is an experienced trial lawyer and trusted strategic advisor with respect to matters of employment law and commercial disputes. He is a partner with Kelly Santini LLP, located in Ottawa, Ontario, Canada.
Twitter Followers 4.2K Frequency 1 post / month Since Apr 2012

140. Christensen Law Blog RSS Feed

RSS Feed davidchristensenlaw.com/feed   Follow RSS Blog davidchristensenlaw.com
Auto accident blog Articles by David Christensen focusing on legal issues for car accident victims who suffer traumatic brain injury. Christensen Law is a preeminent Michigan law firm specializing in personal injury, traumatic brain injury (TBI), wrongful death, truck, car, and motorcycle accidents.
Facebook Followers 4.9KTwitter Followers 281 Frequency 23 posts / year

141. Boston Criminal Lawyer Blog | Altman & Altman LLP RSS Feed

RSS Feed bostoncriminallawyerblog.com..   Follow RSS Blog bostoncriminallawyerblog.com
Boston Criminal Lawyer Blog is published by Boston, Massachusetts Criminal Defense Attorneys, Altman and Altman. The blog provides updates on criminal cases. For over four decades, the law firm Altman and Altman, LLP has been providing outstanding criminal defence legal services to clients in Massachusetts and throughout New England. With decades of experience, their team of bright, aggressive, and hardworking criminal attorneys draw upon their broad base of expertise to provide their clients with the highest quality legal advice.
Facebook Followers 4 Frequency 2 posts / year

142. Canadian Privacy Law Blog RSS Feed

RSS Feed blog.privacylawyer.ca/feeds/..   Follow RSS Blog blog.privacylawyer.ca
Developments in privacy law and writings of a Canadian privacy lawyer, containing information related to the Personal Information Protection and Electronic Documents Act (aka PIPEDA) and other Canadian and international laws.
Twitter Followers 7.4K Frequency 4 posts / quarter Since Jan 2004

143. Pairokar RSS Feed

RSS Feed parokar.blogspot.com/feeds/p..   Follow RSS Blog parokar.blogspot.com
Regular updates and news.
Frequency 1 post / week

144. The Pink Attorney Blog RSS Feed

RSS Feed specificfeeds.com/thepinkatt..   Follow RSS Blog thepinkattorney.com
A blog tackling legal issues and life experiences with honesty, integrity and a dash of humor!
Frequency 1 post / week

145. A Winning Tip RSS Feed

RSS Feed awinningtip.blogspot.com/fee..   Follow RSS Blog awinningtip.blogspot.com
A trial consultant for more than 20 years, I am also a psychologist, author and speaker. I have had the privilege of extensively studying how people think, make decisions and how they commit to those decisions.
Frequency 1 post / quarter Since Nov 2008

146. Kuzyk Law RSS Feed

RSS Feed kuzyklaw.com/feed   Follow RSS Blog kuzyklaw.com
Kuzyk Law has served Lancaster, Palmdale & all of Antelope Valley for over 40 years.
Facebook Followers 1.2KTwitter Followers 38 Frequency 3 posts / month

147. Screw You Guys, I'm Going Home RSS Feed

RSS Feed feeds.feedburner.com/Scre..   Follow RSS Blog employeeatty.blogspot.com
What You Need To Know Before You Scream 'I Quit, 'Get Fired, Or Decide to Sue the Bastards. Author Donna Ballman is an employee-side employment lawyer. She has built a reputation as a skilled and knowledgeable attorney in all of the aspects of labor and employment law. Follow to read her regular articles on employee-side employment law issues.
Facebook Followers 212Twitter Followers 6.8K Frequency 3 posts / quarter Since Oct 2010

148. Ferragut Law Firm | Criminal Defense Attorney RSS Feed

RSS Feed ferragutlaw.com/feed   Follow RSS Blog ferragutlaw.com
Welcome to the Ferragut Law Firm, a top rated criminal defense attorney Phoenix Arizona, dedicated exclusively to the practice of criminal law in all state, federal, and city courts throughout the State of Arizona.
Frequency 1 post / year

149. JDJournal RSS Feed

RSS Feed jdjournal.com/feed   Follow RSS Blog jdjournal.com
JD Journal is a prominent online resource delivering the latest news and insights within the legal industry. As a comprehensive platform, it caters to a broad audience of legal professionals, law students, and academics. The blog is known for its in-depth analysis of current trends, profiles of leading figures in the legal field, and coverage of significant legal events worldwide. While specific details about the editorial team are not readily available, the blog's commitment to thorough and insightful reporting makes it a valuable resource for staying informed about the ever-evolving landscape of law.
Facebook Followers 153 Frequency 8 posts / day

150. The Wall Street Journal » Law-Legal RSS Feed

RSS Feed   Follow RSS Blog wsj.com
Discover the latest and breaking Law news from The Wall Street Journal. The Wall Street Journal was founded in July 1889. Ever since, the Journal has led the way in chronicling the rise of industries in America and around the world. In no other period of human history has the planet witnessed changes so dramatic or swift.
Facebook Followers 7.3MInstagram Followers 4.9M

151. PhD Law Writers Blog RSS Feed

RSS Feed   Follow RSS Blog phdlawwriters.com
The PhD Law Writers Blog covers law dissertations, law case studies, research papers, etc. These posts share writing tips for several types of law assignments. PhD Law Writers is a dedicated team of individuals that provides reliable & trustworthy assignments of law academics for students all across the country.
Instagram Followers 1.3K Frequency 12 posts / year

152. 4M Legal and Tax Law Firm RSS Feed

RSS Feed 4mlegaltax.com/feed   Follow RSS Blog 4mlegaltax.com
Uncover the latest News & Insights illuminating the legal landscape. Read careful analyses, market reports, and other relevant stories. 4M Legal and Tax law firm is an experienced bilingual Law Firm in Douala, Cameroon, and offers full-service legal, regulatory, and tax solutions, bridging West and Central Africa.
Facebook Followers 23 Frequency 1 post / month

153. Reuters » Legal RSS Feed

RSS Feed   Follow RSS Blog reuters.com
Reuters, the news and media division of Thomson Reuters, is the world's largest multimedia news provider, reaching billions of people worldwide every day. Reuters provides business, financial, national, and international news to professionals via desktop terminals, the world's media organizations, industry events, and directly to consumers.
Facebook Followers 7.1MInstagram Followers 4.9M

154. Rocket Lawyer Everyday Law Blog RSS Feed

RSS Feed rocketlawyer.com/blog/feed   Follow RSS Blog rocketlawyer.com
Everyday Law helps you identify the ways the law can make your life better. Find tips about timely legal topics and learn how people like you manage their issues. Rocket Lawyer makes the law work for you at a price you can afford.
Facebook Followers 27.9KTwitter Followers 14.2K

155. Latham & Watkins RSS Feed

RSS Feed   Follow RSS Blog lw.com
Latham & Watkins is a global law firm with more than 3,000 lawyers in its offices located in Asia, Europe, the Middle East, and the United States. The firm has internationally recognized practices in a wide spectrum of transactional, litigation, corporate and regulatory areas. Our success is grounded in our devotion to the collaborative process, which reaches across global offices and practices and draws upon our deep subject matter expertise, an abiding commitment to teamwork, and a powerful tradition of creative lawyering.
Facebook Followers 10.8KInstagram Followers 5.1K

156. The Fashion Law RSS Feed

RSS Feed thefashionlaw.com/feed   Follow RSS Blog thefashionlaw.com
The Fashion Law provides well-curated, research-driven news and insights into the legal and business aspects of the rapidly evolving fashion industry. Julie Zerbo is the founder and editor-in-chief of The Fashion Law.
Facebook Followers 19.7KTwitter Followers 88.8KInstagram Followers 157K Since Jan 2014

157. The Biglaw Investor RSS Feed

RSS Feed biglawinvestor.com/feed   Follow RSS Blog biglawinvestor.com
The Biglaw Investor is a finance and investing blog for smart lawyers who want to build wealth and achieve financial independence. Topics covered are Asset Protection, Financial Independence, Investing, Taxes, and Loans.
Twitter Followers 3.9KInstagram Followers 746 Frequency 1 post / month Since May 2016

158. Blumberg RSS Feed

RSS Feed blog.blumberg.com/index.php/..   Follow RSS Blog blog.blumberg.com
Serving the legal community since 1887. This blog is prepared for general information purposes to permit you to learn more about our company, our products & services, and the events affecting our business community. We cover Legal Supplies, Marketing Services, Legal Pads, Tax Information, Corporate Seals, and Publication Services.
Twitter Followers 297 Since Oct 2020

159. Dezan Shira & Associates RSS Feed

RSS Feed dezshira.com/feed   Follow RSS Blog dezshira.com
Keep up with our regular insights & thought leadership regarding economic regulatory & operating conditions, upcoming events, webinars, and more. Dezan Shira & Associates is a multi-disciplinary professional services firm, providing legal, tax, and operational advisory to international corporate investors operational throughout China, ASEAN, and India.
Facebook Followers 1.4KTwitter Followers 1.4K

160. Chugh LLP News RSS Feed

RSS Feed chugh.com/feed   Follow RSS Blog chugh.com
Covers Accounting, Arbitration Clause, California Law, Contract law, Data Privacy, Hotel Law, Immigration, Family Law, Tax Law, and Workplace Inspections. Chugh, LLP is a full-service Law & CPA Firm specializing in Immigration, Corporate, Taxation, Litigation, and Employment with offices in the USA & India.
Facebook Followers 12.4KTwitter Followers 7.9KInstagram Followers 650 Since May 2020

161. CL&P Blog RSS Feed

RSS Feed pubcit.typepad.com/clpblog/i..   Follow RSS Blog pubcit.typepad.com
Updates and ideas about consumer law and policy by lawyers and law professors. The blog is hosted by the Public Citizen Litigation Group.

162. Truth Legal Solicitors | Personal Injury, Medical Negligence, Immigration and Employment Law RSS Feed

RSS Feed truthlegal.com/latest-news/feed   Follow RSS Blog truthlegal.com
Truth Legal pursues justice. We strive to provide the most caring, thorough and individual personal injury, employment, clinical negligence legal representation available. Truth Legal Solicitors are an ethical, tenacious and affordable law firm.
Facebook Followers 531Twitter Followers 2.1K

163. Law with Shaheen RSS Feed

RSS Feed lawwithshaheen.com/feed   Follow RSS Blog lawwithshaheen.com
Learn Law To Protect Your Rights
Twitter Followers 113 Frequency 11 posts / year

164. In House Blog RSS Feed

RSS Feed   Follow RSS Blog inhouseblog.com
InhouseBlog® and its job board, GoInhouse®, are owned and operated by Law Department Solutions, LLC. InhouseBlog was co-founded by Geoffrey Gussis (LinkedIn), who serves as Managing Editor, and Amar Maktal (LinkedIn), who serves as Chief Technologist. InhouseBlog® was selected as a Top 100 Blawg by the ABA Journal (2008), nominated as a Top 25 Business Law Blog by LexisNexis (2010), selected as the Runner-Up for the Best Practice Specific Blawg in Dennis Kennedy's 2011 Blawggie Awards and 2013 Blawggie Awards, and won the Best Practice Specific Blawg in those awards in 2014 and 2015.
Frequency 1 post / month

165. The Law Office of Gaynell Williams LLC Blog RSS Feed

RSS Feed gaynellwilliamslaw.com/blog-..   Follow RSS Blog gaynellwilliamslaw.com
As a New Orleans-based law firm, the experienced criminal defense lawyers at Gaynell Williams, LLC represent clients who have been arrested on misdemeanor charges, drug charges, property and theft charges, DWI/DIU charges, federal charges, and white-collar crime charges to name a few. Each criminal defense attorney in their office tailors their aggressive representation to fit each client's criminal defense needs and works with the top investigators and experts in the field to make sure that no stone is left unturned and no avenue of defense is left unexplored.
Facebook Followers 495Twitter Followers 15Instagram Followers 270 Frequency 20 posts / year

166. Legal Theory Blog RSS Feed

RSS Feed lsolum.typepad.com/legaltheo..   Follow RSS Blog lsolum.typepad.com
Blog articles focus on legal theory and its interpretation in the current era. Lawrence Solum is a Law Professor at University of Virginia, JD Harvard Law, and teaches Originalism, virtue jurisprudence, AI, normative legal theory.
Twitter Followers 9.9KInstagram Followers 1.5K Frequency 30 posts / year Since Sep 2002

167. Law And More | Deconstructing What Happens in Law RSS Feed

RSS Feed lawandmore.typepad.com/law_a..   Follow RSS Blog lawandmore.typepad.com
Jane Genova is the creator of the Law And More blog, where she deconstructing what happens in law. She helps you sell yourself to your target markets (including future employers).

168. New York Personal Injury Law Blog RSS Feed

RSS Feed feeds.feedburner.com/NewY..   Follow RSS Blog newyorkpersonalinjuryattorneyblog.com
New York Personal Injury Law Blog by Eric Turkewitz, is an attorney's blog on New York personal injury law, medical malpractice, the civil justice system and cases of interest. Eric Turkewitz has tried personal injury cases to verdict in New York, Bronx, Brooklyn, Queens, Staten Island, Nassau, Suffolk, Westchester, Rockland, Dutchess and Albany counties. He has argued appeals in the the Second Circuit Court of Appeals, Appellate Division First Department and Appellate Division Second Department.
Since Nov 2006

169. Jersey Criminal Attorneys RSS Feed

RSS Feed jerseycriminalattorney.com/feed   Follow RSS Blog jerseycriminalattorney.com
New Jersey Criminal Lawyers - Dedicated to defending & protecting people charged with crimes

170. Law Office of Steven Rodemer, LLC Blog RSS Feed

RSS Feed   Follow RSS Blog coloradospringscriminaldefense.net
Posts on Criminal defense, Colorado Domestic Violence Defense, Colorado Misdemeanor Defense, and generic legal information. Steven Rodemer is a Colorado Springs Criminal Defense Attorney specializing in DUI, DWAI, and domestic violence defense.
Frequency 11 posts / year

171. Donich Law | Toronto Criminal Lawyers RSS Feed

RSS Feed mydefence.ca/category/crimin..   Follow RSS Blog mydefence.ca
Toronto Law Firm providing legal solutions in Criminal Defence, Professional Regulation and Civil Litigation.

172. Law21 Blog RSS Feed

RSS Feed law21.ca/feed   Follow RSS Blog law21.ca/blog
Jordan Furlong, a prominent analyst of the global legal market, offers invaluable insights into its evolution. Legal firms seek Law21 consultancy to grasp radical changes and build sustainable enterprises. Jordan advises lawyers on crafting competitive strategies to thrive in the evolving legal services landscape.
Frequency 1 post / year

173. Beyond Billables Blog RSS Feed

RSS Feed   Follow RSS Blog beyondbillables.com
From marketing strategy to personal branding, social media to inspiring stories, the blog is all about free advice for anyone with the ambition to make something great of their business. Beyond Billables are branding experts for legal and professional firms and specialise in assisting law firms and professionals build valuable reputations.
Facebook Followers 3.8KInstagram Followers 4.2K Frequency 18 posts / year

174. Sentencing Law and Policy RSS Feed

RSS Feed sentencing.typepad.com/sente..   Follow RSS Blog sentencing.typepad.com
Sentencing Law and Policy blog provides information and commentary about guidelines and capital sentencing. Professor Berman is the sole creator and author of the Sentencing Law and Policy blog. Professor Berman provides consulting services on various cutting-edge federal sentencing issues. He also is frequently contacted by the media concerning sentencing developments.
Twitter Followers 4.8K Frequency 30 posts / year Since May 2004

175. Ruth Carter | Carter Law Firm RSS Feed

RSS Feed feeds.feedburner.com/CarterL..   Follow RSS Blog carterlawaz.com
Carter Law Firm provides legal services in the areas of intellectual property, social media law, business law, & flash mob law. Ruth Carter is an Arizona business attorney, Phoenix business lawyer, intellectual property, internet law - Lawyer. Author. Professional Speaker.
Facebook Followers 896Twitter Followers 2.8K

176. In-House Ops | Leading High-Performance Law Department RSS Feed

RSS Feed inhouseops.com/feed   Follow RSS Blog inhouseops.com
In-House Ops is published by Law Business Media. For almost 25 years, Corporate Counsel Business Journal (formerly Metropolitan Corporate Counsel) has delivered leading-edge information to the in-house community. MCC's founder, Al Driver, former General Counsel of one of the world's leading retailers, was committed to partnering with the world's leading corporate law department leaders and outside counsel from elite law firms to deliver the essential information needed to be a successful general counsel.
Facebook Followers 214Twitter Followers 3.5K Frequency 20 posts / year Since Feb 2016

177. The Legal Satyricon RSS Feed

RSS Feed feeds.feedburner.com/TheLega..   Follow RSS Blog randazza.wordpress.com
The primary goal of Randazza Legal Group is to protect your freedoms. We defend your right to speak freely, to control and protect your creative work, to be treated without discrimination, and to be free from harassment when people don't like what you have to say.
Facebook Followers 669

178. Northwest Business Law Blog RSS Feed

RSS Feed   Follow RSS Blog nwbizlaw.com
Key topics covered are Business Law, Breach of Contract, Business Assets, Corporate Law Suits, Intellectual Property Litigation, and Partnership disputes. Northwest Business Law's mission is to assist entrepreneurs and small to mid-size companies in the navigation of their legal needs and business strategies.
Frequency 3 posts / year

179. Ethical Investigator RSS Feed

RSS Feed ethicalinvestigator.com/feed   Follow RSS Blog ethicalinvestigator.com
The Ethical Investigator by Charles Griffin Intelligence covers asset search, due diligence, and other private corporate investigation matters. Charles Griffin Intelligence is a New York-based consulting firm that assists lawyers, corporations, and individuals with fact-finding for global litigation and due diligence.
Facebook Followers 8Twitter Followers 655 Frequency 1 post / quarter Since Mar 2011

180. The Legal Reports RSS Feed

RSS Feed thelegalreports.com/feed   Follow RSS Blog thelegalreports.com
First and Leading legal news and media website in Uganda. At The legal reports, we make sure you are updated with all law and legal affairs in Uganda.
Facebook Followers 2.6KTwitter Followers 1.8K Frequency 30 posts / year

181. The Expert Institute RSS Feed

RSS Feed expertinstitute.com/resource..   Follow RSS Blog expertinstitute.com
Blog posts cover Legal News, Expert Insights, Legal Tech Solutions, Litigation Monitor, Trial Tactics, Cross-Examination, and Establishing Damages & Liability. Expert Institute is the leading expert witness services firm that connects attorneys with the exceptional expertise they need to win more cases.
Facebook Followers 1.6K Frequency 30 posts / year

182. SenftLegal RSS Feed

RSS Feed   Follow RSS Blog senftlegal.com
Scott Senft and his team of law experts provide you with diverse possible solutions to your legal issues and explain them to you.
Twitter Followers 15

183. The Law Product Makers Blog RSS Feed

RSS Feed lawproductmakers.com/feed   Follow RSS Blog lawproductmakers.com
Covers articles about the legal issues such as virtual lawyering, storing data in the cloud, ethical issues around the online delivery of legal services, and other topics. The Law Product Makers Blog is for lawyers and others who are interested in the subject of productizing legal services.
Facebook Followers 2Twitter Followers 4.4K Frequency 1 post / year

184. The Blog for Business Law RSS Feed

RSS Feed theblogforbusinesslaw.com/feed   Follow RSS Blog theblogforbusinesslaw.com
The Blog for Business Law is a blog about business, the law, and fun. The lawyers regularly post articles and alerts on emerging business, legal, judicial and regulatory developments in areas such as intellectual property, human resources, construction and real estate, environmental compliance, and the many, many considerations that arise when buying and selling businesses.
Twitter Followers 232

185. Mack's Criminal Law Blog RSS Feed

RSS Feed mackscriminallaw.com/law-blo..   Follow RSS Blog mackscriminallaw.com
Mack's Criminal Law Blog provides insight, information and resources. It is dedicated to providing up-to-date and insightful information and blog posts on Canadian criminal law. It is an invaluable resource for criminal lawyers, judges and students.
Twitter Followers 747 Frequency 1 post / year

186. FDA Law Blog RSS Feed

RSS Feed fdalawblog.net/feed   Follow RSS Blog thefdalawblog.com
A blog by Food and Drug Attorneys at Hyman, Phelps & McNamara, P.C. Blog posts cover FDA News, Orphan Drugs, Animal Drugs & Feeds, cGMP Compliance, Dietary Supplements, Health Privacy, Reimbursement, and Orphan Drugs.
Twitter Followers 4.7K Frequency 9 posts / quarter

187. ICL Media Review RSS Feed

RSS Feed iclmediareview.com/feed   Follow RSS Blog iclmediareview.com
Created in January 2011, ICL Media Review is a daily survey of international criminal and international human rights news and developments which affect international law. It aims to provide its survey of news and events in a neutral and impartial manner.
Facebook Followers 481Twitter Followers 2.8K Since Jan 2011

188. Gore & Kuperman Blog RSS Feed

RSS Feed goreandkuperman.com/blog/feed   Follow RSS Blog goreandkuperman.com
Follow this blog to find factful information about Criminal Laws, Personal Injury Laws, Civil Litigation and get top answers form Mark Gore & Boris Kuperman.
Facebook Followers 1.1KTwitter Followers 96 Frequency 21 posts / year Since May 2018

189. LAWPHILIC RSS Feed

RSS Feed lawphilic.law.blog/feed   Follow RSS Blog lawphilic.com
Consistent & committed to providing legal awareness, opportunities and knowledge via our legal videos, write-ups, posts, and much more.
Facebook Followers 61Twitter Followers 5Instagram Followers 78 Frequency 1 post / quarter

190. Corporate Law and Governance RSS Feed

RSS Feed corporatelawandgovernance.bl..   Follow RSS Blog corporatelawandgovernance.blogspot.com
His site's primary focus is the UK but interesting items from other jurisdictions are often included as are developments in the allied disciplines of capital market regulation and financial reporting.
Twitter Followers 181 Since Jan 2008

191. Online Legal Translations RSS Feed

RSS Feed onlinelegaltranslations.com/..   Follow RSS Blog onlinelegaltranslations.com
Online Legal Translations provides Quality Legal Translations performed solely by Lawyer-Translators. We provide quality, professional translation services for Corporate Legal Departments, Law Firms, Government Entities, and Individuals.
Facebook Followers 1.3KTwitter Followers 233Instagram Followers 226 Since Oct 2017

192. Wheeler Law Firm, LLC RSS Feed

RSS Feed awheelerlaw.com/feed   Follow RSS Blog awheelerlaw.com
Wheeler Law Firm is an experienced Family Law Firm serving Indianapolis and surrounding areas.
Facebook Followers 269

193. Sinka llc RSS Feed

RSS Feed sinkallc.com/feed   Follow RSS Blog sinkallc.com
Sinka llc is a proactive boutique law firm, with a global perspective and attention to detail. We are based in Cyprus and represent closely-held businesses, families, and high net worth individuals.
Twitter Followers 3K

194. Cook Law, LLC RSS Feed

RSS Feed cooklawyerllc.com/feed   Follow RSS Blog cooklawyerllc.com
Get more information by reading our blogs about credit reporting errors, personal injury, car accidents, and background checks.
Facebook Followers 108 Frequency 1 post / year

195. Elawvation RSS Feed

RSS Feed elawvation.com/feed   Follow RSS Blog elawvation.com
Tools and news for lawyers, attorneys. Wellness and wellbeing news. Work-life balance secrets. Lawyer's life. Fashion for lawyers
Facebook Followers 253Instagram Followers 1.1K Frequency 1 post / year

196. Khashan Law RSS Feed

RSS Feed khashanlaw.com/feed   Follow RSS Blog khashanlaw.com
The Khashan Law Firm is a full-service general practice law center representing clients throughout Southern California in a wide array of legal issues. Although the Khashan Law Firm primarily focuses on representing individuals injured in all types of accidents, our Attorneys have a wide variety of experience and knowledge and have represented thousands of clients in serious Personal Injury cases and more.
Facebook Followers 1.3KInstagram Followers 797 Frequency 23 posts / year Since Nov 2017

197. Law Daily RSS Feed

RSS Feed blogger.com/feeds/3239069528..   Follow RSS Blog thelawdaily.blogspot.com
The Law Daily publishes articles related to the field of law throughout the year and aims towards accomodating every qualitative submission to create an open-access platform for legal news.
Instagram Followers 121 Frequency 9 posts / year

198. AishMGhrana | Law Governance Responsibility RSS Feed

RSS Feed aishmghrana.me/feed   Follow RSS Blog aishmghrana.me
Writer of this blog, Aishwarya Mohan Gahrana is Practicing Company Secretary and Insolvency Professional working with M/s Aishwarya M Gahrana & Associates, a New Delhi based peer reviewed firm of company secretaries having pan India presence through friends and associates.
Facebook Followers 6.5KTwitter Followers 925Instagram Followers 216 Frequency 4 posts / year Since Feb 2011

199. Bagneris Law Firm Blog RSS Feed

RSS Feed bagnerislawfirm.com/feed   Follow RSS Blog bagnerislawfirm.com
Suzette Bagneris is the owner of the Bagneris Law Firm located in New Orleans, Louisiana. She brings unparalleled passion and compassion to each case. Personal Injury and Criminal Litigation Firm that has consistently obtained multi-million dollar settlements and verdicts for clients in Louisiana. The firm is an experienced civil litigation firm with decades of combined experience serving both plaintiffs and defendants in a wide range of different cases. These different legal cases include both personal injury cases and business disputes.
Facebook Followers 436Twitter Followers 40 Since Oct 2018

200. Louis Lehot Blog RSS Feed

RSS Feed louislehot.com/feed   Follow RSS Blog louislehot.com
Keep up with the latest news and updates on the Louis Lehot blog. Louis Lehot helps businesses and ventures with compelling technologies reach their growth objective with sound legal strategies and solutions.
Facebook Followers 9.3KTwitter Followers 1.2K Frequency 1 post / year

201. The Cyprus Lawyer RSS Feed

RSS Feed thecypruslawyer.com/feed   Follow RSS Blog thecypruslawyer.com
The life and practise of a lawyer in Cyprus. Harris Sharpe is a qualified lawyer practising in Cyprus with extensive experience in corporate and commercial law.
Facebook Followers 750Twitter Followers 441 Frequency 1 post / year

202. Ernest G. Ianetti, Esq. RSS Feed

RSS Feed ianetti.legal/answers?format..   Follow RSS Blog ianetti.legal
Over 30 Years of Professional Experience in Bankruptcy, Family Law, and Criminal Law. Personal, practical solutions to complex bankruptcy, family law & criminal defense legal matters.
Facebook Followers 4

203. M|L|B RSS Feed

RSS Feed malasevschi.wordpress.com/feed   Follow RSS Blog malasevschi.wordpress.com
The M|L|B is an initiative which aims to approach important decisions of national and EU courts and law related issues.
Facebook Followers 246Twitter Followers 35Instagram Followers 659

204. Cultural Heritage Lawyer Rick St. Hilaire RSS Feed

RSS Feed culturalheritagelawyer.blogs..   Follow RSS Blog culturalheritagelawyer.blogspot.com
A lawyer's commentary on cultural property law and cultural heritage law; the illegal antiquities trade; looted, stolen, smuggled, and illicit artifacts; art theft; museum administration and risk management; and the laws and lawyers impacting cultural heritage, cultural property protection, antiquities dealers, auction houses, and archaeology.
Twitter Followers 3.2K Since Jan 2010

205. Iowa Employment Law Blog RSS Feed

RSS Feed iowaemploymentlawblog.com/feed   Follow RSS Blog iowaemploymentlawblog.com
Iowa Employment Law Blog is written by Patrick Smith of Bradshaw Fowler Proctor & Fairgrave, PC's Employment & Labor practice group focusing on matters related to employment & labor litigation, disputes, benefits, unfair practice, and wage & hour claims in Iowa.
Twitter Followers 54

206. Gordon & Rees Construction Law Blog RSS Feed

RSS Feed grconstructionlawblog.com/feed   Follow RSS Blog grconstructionlawblog.com
Gordon & Rees Construction Law Blog is a forum on Key Legal Issues for Design Professionals, Contractors and Developers.
Twitter Followers 1.2K Frequency 1 post / year

207. Power Legal Group Blog RSS Feed

RSS Feed powerlegalgroup.com/blog/feed   Follow RSS Blog powerlegalgroup.com
LA Personal Injury Lawyer Bobby Yaghoubian started the Power Legal Group because he wanted to have a Los Angeles law firm that offered aggressive representation combined with personalized service. They are dedicated to serving all of the people of Southern California from all walks of life and pursuing maximum compensation in every case they take.
Facebook Followers 80Twitter Followers 19

208. Schiffrinpa | South FL Personal Injury Attorney RSS Feed

RSS Feed schiffrinpa.com/feed   Follow RSS Blog schiffrinpa.com
Read the personal injury & accident law blog blog by the attorneys at Mark Schiffrin P. A. Find all the legal resources and help in Florida.
Facebook Followers 60

209. Shiner Law Group RSS Feed

RSS Feed masstortlawyer.org/feed   Follow RSS Blog masstortlawyer.org
We are Top Attorneys Handling Mass Tort Litigation and Class Action Lawsuits.
Facebook Followers 3KInstagram Followers 2.2K

210. Export Law Blog RSS Feed

RSS Feed exportlawblog.com/feed   Follow RSS Blog exportlawblog.com
On the Export Law Blog, Clif Burns provides latest news on DDTC, BIS, OFAC, and other export law matters. Mr. Burns is a Bryan Cave LLP attorney specializing in export control and economic sanctions.
Twitter Followers 533 Since Nov 2013

211. Real Legal News RSS Feed

RSS Feed reallegalnews.com/feed   Follow RSS Blog reallegalnews.com
Real Legal News (RLN) is a collection of legal news and information from in house reporters and local attorneys. Our goal is to inform and educate the public about everything legal.
Since Oct 2019

212. softrights RSS Feed

RSS Feed thaworldtakes.com/feed   Follow RSS Blog thaworldtakes.com
This blog aims to entertain and inform, in that order. Want legal advice? Look elsewhere. Better yet, call me!
Frequency 1 post / year Since Apr 2012

213. Welcome to the law basic RSS Feed

RSS Feed laymanlawbasics.blogspot.com..   Follow RSS Blog laymanlawbasics.blogspot.com
A blog about basic facts, environment related topics, general topics and law related information.

214. Pecori and Pecori Attorneys at Law RSS Feed

RSS Feed pecorielderlaw.blogspot.com/..   Follow RSS Blog pecorielderlaw.blogspot.com
Pecori & Pecori is a third generation law firm founded in 1940. We offer the high-quality personal service that only a small firm can provide. Whether you need a Pittsburgh Estate Planning Lawyer, a Pittsburgh Probate Lawyer or a Pittsburgh Elder Law Lawyer, we can help you.
Since Feb 2020

215. Estrin Legal Staffing RSS Feed

RSS Feed estrinlegalstaffing.com/feed   Follow RSS Blog estrinlegalstaffing.com
Over 25 years of staffing experience in AmLaw200 law firms and in-house legal departments. We practice ethical recruiting and offer clients and candidates top-tier service. You'll get the benefit of our proven track record as we work hard for you whether we are recruiting for you or helping you find that dream job.
Facebook Followers 23 Frequency 1 post / quarter

216. Joshua Rogala | Winnipeg Criminal Defence Lawyer RSS Feed

RSS Feed winnipegcriminaldefencelawye..   Follow RSS Blog winnipegcriminaldefencelawyer.ca
Joshua Rogala's legal blog provides information about the law, Winnipeg news stories, and tid-bits of information that are both interesting and educational.
Twitter Followers 42 Frequency 25 posts / year

217. Flock of Legals RSS Feed

RSS Feed flockoflegals.com/feed   Follow RSS Blog flockoflegals.com
Covers articles on California Criminal Law, DUI Law, Personal Injury Law, Traffic Tickets, and more. Flock of Legals is created by California lawyers with the primary goal of creating a free legal database of legal information accessible to all.
Facebook Followers 135Twitter Followers 18 Since Mar 2018

218. The Rainmaker Blog | Law Firm Marketing & Business Development RSS Feed

RSS Feed therainmakerblog.com/feed   Follow RSS Blog therainmakerblog.com
The Rainmaker Blog provides law firm marketing and business development strategies. It is published by The Rainmaker Institute. Stephen Fairley is the CEO of The Rainmaker Institute.
Twitter Followers 26.7K

219. Hoban Law Group RSS Feed

RSS Feed hoban.law/feed   Follow RSS Blog hoban.law
Stay up to date with Cannabis Industry Insights. Hoban Law Group is an industrial hemp & cannabis industry law firm, recognized in the canna-business, industrial hemp farming, and hemp production community
Facebook Followers 3KTwitter Followers 2.3K

220. HarryClarkLaw Blog RSS Feed

RSS Feed hclark.law.blog/feed   Follow RSS Blog harryclarklaw.com
Articles are geared towards aspiring solicitors, covering a variety of legal topics from Training Contract applications, to commercial awareness, to my own personal insights into the world of law. Harry Clark is a Trainee Solicitor, law blogger, and tech enthusiast.
Twitter Followers 491Instagram Followers 4.1K

221. Legal Edge Services RSS Feed

RSS Feed legaledgeservices.com/feed   Follow RSS Blog legaledgeservices.com
This blog for attorneys by Legal Edge Services features tips to help you to be more productive and proven ways to increase billable hours. Legal Edge Services is the premier provider of turn-key law office solutions for the legal community.
Facebook Followers 832 Frequency 3 posts / quarter

222. Seda Law Firm RSS Feed

RSS Feed   Follow RSS Blog sedalawfirm.com
Covers articles related to estate planning, probates, and real property matters. Seda Law Firm PLLC is based in Oklahoma City serving clients in Oklahoma, Texas, New Mexico and North Dakota.
Facebook Followers 601

223. Legal Support World RSS Feed

RSS Feed legalsupportworld.blogspot.c..   Follow RSS Blog legalsupportworld.blogspot.com
Since 2008, Legal Support World has been offering legal outsourcing services and legal support solutions through innovative thought leaders who put forth their knowledge and experience to fulfill the individual expectations of each client. We are a leading, pure-play outsourcing company that helps clients augment their internal capabilities and retain superior quality and proficiency with utmost cost effectiveness.
Facebook Followers 743Twitter Followers 1.3K Frequency 2 posts / year Since Nov 2014

224. KS Legal and Associates RSS Feed

RSS Feed kslegal.co.in/feed   Follow RSS Blog kslegal.co.in
KS Legal and Associates blog contains posts on various legal-related information, such as family, divorce, property, insurance, banking, commercial, etc. As a boutique law firm, KS Legal provides top-quality advice on corporate and commercial law for everyone from blue-chip companies to start-ups and is a go-to for international firms and clients.

225. Bloomsbury Law Online Blog RSS Feed

RSS Feed law.bloomsburyprofessional.c..   Follow RSS Blog law.bloomsburyprofessional.com
A comprehensive source of information to the UK tax & accountancy markets. Features articles on Family Law, Intellectual Property & Media Law, Employment Law, and Company & Commercial Law. Bloomsbury Tax is part of Bloomsbury Professional, the UK's leading independent law & tax publisher.
Facebook Followers 340Twitter Followers 3.5KInstagram Followers 53 Since Mar 2011

226. Knowledge Of The Law RSS Feed

RSS Feed knowledgeofthelaw.com/feed   Follow RSS Blog knowledgeofthelaw.com
Knowledge Of The Law is a legal blog. We share tips on how to become a lawyer, law students' tips, law school guides and tips, definitions of various law courses, how to find a lawyer, hiring a good lawyer, paralegal tips, and lawyers' salaries.
Facebook Followers 52 Frequency 4 posts / quarter

227. The Contracts Guy RSS Feed

RSS Feed feeds.feedburner.com/thecont..   Follow RSS Blog thecontractsguy.net
Hi, I'm Brian Rogers, a business law attorney licensed in Missouri and Illinois and practicing in St. Louis. I'm the founder of Blue Maven Law, LLC, a business law firm that focuses on helping buyers and sellers of small businesses navigate the legal aspects of their transactions, company formation, contracts, and general business law advice.

228. Construction Law Signal RSS Feed

RSS Feed constructionlawsignal.com/feed   Follow RSS Blog cohenseglias.com
Construction Law Signal is written by the Construction Lawyers at Cohen Seglias Law Firm and offers legal updates and insights on Construction matters. The blog is designed to provide regular news on construction related issues in the Mid-Atlantic region, with practical commentary and analysis from the Cohen Seglias Construction Group.
Facebook Followers 185Twitter Followers 536

229. Bloomberg Law Podcast RSS Feed

RSS Feed feeds.bloomberg.fm/BLM529674..   Follow RSS Blog bloomberg.com
Bloomberg Law Podcast examines all aspects of the legal profession, from intellectual property law to criminal law, from bankruptcy to securities law, drawing on the deep research tools of BloombergLaw. In each episode, Host June Grasso speaks with prominent attorneys to analyze major legal issues & cases in the news.
Facebook Followers 4.2MTwitter Followers 7.8MInstagram Followers 5.3M Since Nov 2016

230. Zegal RSS Feed

RSS Feed   Follow RSS Blog zegal.com
Covers articles on small business legal and commercial issues, latest legal and business tips, tools and resources. Zegal is the end-to-end platform for the legals smaller companies need.
Facebook Followers 3.1KTwitter Followers 1.7K

231. Lawrina RSS Feed

RSS Feed   Follow RSS Blog lawrina.com/blog
Covers news, comprehensive insights, and legal advice. Lawrina helps to understand American law by making legal information available in a simple, systematic, and accessible way.
Facebook Followers 119Twitter Followers 63

232. Scarinci Hollenbeck » Law Firm Insights RSS Feed

RSS Feed   Follow RSS Blog scarincihollenbeck.com
Articles feature the latest firm insights and topics including Business Law, Entertainment and sports, Labor and employment, IP, Cybersecurity, Environmental law, Cannabis, Tax, and more. Scarinci Hollenbeck is a full-service, general practice business law firm that provides a broad range of legal services to a diverse group of clients.
Facebook Followers 1.9KTwitter Followers 7.5K

233. Sheria Na Jamii RSS Feed

RSS Feed sherianajamii.blogspot.com/f..   Follow RSS Blog sherianajamii.com
A blog about legal articles, cases, legal documents, substantive laws, procedural laws, and other legal affairs worldwide. Sheria Na Jamii is a free online platform for varieties of legal content on selected topics of several legal affairs worldwide.
Twitter Followers 826

234. Attorney-At-Law Journal RSS Feed

RSS Feed attyatlawjournal.blogspot.co..   Follow RSS Blog attyatlawjournal.blogspot.com
Attorney-At-Law Journal is a pesonal blogsite sharing the pursuits in life, law and love
Since Aug 2012

235. JETLaw | Vanderbilt Journal Of Entertainment & Technology Law RSS Feed

RSS Feed jetlaw.org/feed   Follow RSS Blog vanderbilt.edu
JETLaw is committed to reaching a wide audience by providing a forum for dialogue between scholars, students, and practitioners on all legal matters pertaining to the fields of entertainment and technology. The Vanderbilt Journal of Entertainment and Technology Law is an official, highly ranked, student-run publication of Vanderbilt University Law School and publishes four issues annually.
Facebook Followers 333Twitter Followers 321

236. Sports and Entertainment Law Insider RSS Feed

RSS Feed sportslawinsider.com/feed   Follow RSS Blog sportslawinsider.com
Sports and Entertainment Law Insider is your all-access pass to the latest legal developments impacting the business of sports and entertainment.
Since Jun 2012

237. Expert Witness Blog RSS Feed

RSS Feed advancedassessments.co.uk/Bl..   Follow RSS Blog advancedassessments.co.uk
The Advanced Assessments blog offers expert insights into psychological assessments and mental health evaluations. Authored by Dr. Shaun Davis and his team, the blog covers a range of topics including forensic psychology, clinical assessments, and therapy. The goal is to provide valuable information and resources for individuals and professionals seeking to understand and improve mental health through comprehensive assessments.
Facebook Followers 170Twitter Followers 92

238. Race and the Law Prof Blog RSS Feed

RSS Feed lawprofessors.typepad.com/ra..   Follow RSS Blog lawprofessors.typepad.com
Law Professor Blogs, LLC is the nation's only network of legal blogs edited primarily by law professors. Law Professor Blogs, LLC's legal blogs are edited by over 100 law professors, deans, and lawyers. Editors include leading scholars and educators who are committed to providing the web source of legal news, information, commentary, and analysis for law professors, practitioners, government and nonprofit lawyers, and students in their respective fields. Most of the network's blogs are owned by Law Professor Blogs, LLC. Several blogs are affiliates of the network.

239. Overlawyered RSS Feed

RSS Feed overlawyered.com/feed   Follow RSS Blog overlawyered.com
Overlawyered, published by the Cato Institute in 2013, began in July 1999 and is regularly described as the oldest law blog; at least, no one seems to be able to name one that's older. Its founder and predominant writer are Walter Olson, a senior fellow at Cato and author of several books about the U.S. legal system including The Litigation Explosion, The Excuse Factory, The Rule of Lawyers, and Schools for Misrule.

Show 240 to 8527