Top 100 Law RSS Feeds
Law RSS Feeds
Here are 100 Best Law RSS Feeds you should follow in 2024
1. SCOTUSblog RSS Feed
RSS Feed scotusblog.com/feed Follow RSS Blog scotusblog.com
Devoted to covering the US Supreme Court and its cases. Written by lawyers, students, and journalists, SCOTUS Blog is widely regarded as one of the nation's premier legal Internet sites.
Facebook Followers 37.5KTwitter Followers 508K Frequency 1 post / day Export RSS feeds list Get access to 250k active RSS feeds of news websites, blogs, magazines and podcasts with email contacts in 1500 niche categories. Get targeted RSS list in your niche at your fingertips. Email us the categories of RSS feeds you're interested in at anuj@feedspot.com . We'll share the list in an Excel spreadsheet or CSV format.Email us Export RSS List
2. ABA Journal RSS Feed
RSS Feed feeds.feedburner.com/abajour.. Follow RSS Blog abajournal.com
Get continuous news updates from the United States' most-read and most-respected legal affairs magazine and website, ABA Journal. It is the flagship magazine of the American Bar Association, covering the trends, people, and finances of the legal profession from Wall Street to Main Street to Pennsylvania Avenue.
Facebook Followers 26.1KTwitter Followers 107.2KInstagram Followers 7.2K Frequency 7 posts / week
3. Above the Law RSS Feed
RSS Feed abovethelaw.com/feed Follow RSS Blog abovethelaw.com
A behind-the-scenes look at the world of law. The site provides news & insights about the profession's most colorful personalities and powerful institutions, as well as original commentary on breaking legal developments. Above the Law is published by Breaking Media.
Facebook Followers 75.1KTwitter Followers 182.9K Frequency 19 posts / day
4. Lawyerist.com RSS Feed
RSS Feed feeds.feedburner.com/solosma.. Follow RSS Blog lawyerist.com
Lawyerist is home to the largest online community of solo and small-firm lawyers in the world.Their goal is to help lawyers build better law practices by bringing together a group of innovative lawyers to share ideas, experiments, and best practices.
Facebook Followers 21.7KTwitter Followers 59.2KInstagram Followers 2K Frequency 1 post / week Since Jan 2007
5. New Jersey Law Journal RSS Feed
RSS Feed feeds.feedblitz.com/law/lega.. Follow RSS Blog law.com
New Jersey Law Journal delivers news, insights, and resources that allow legal professionals to anticipate opportunities, adapt to change, and prepare for future success. It delivers resources that allow legal professionals to anticipate opportunities, adapt to change, and prepare for future success.
Facebook Followers 8.9KTwitter Followers 57.8K Frequency 14 posts / day
6. The Volokh Conspiracy RSS Feed
RSS Feed reason.com/category/volokh/f.. Follow RSS Blog reason.com
The Volokh Conspiracy is a blog, written mostly by law professors and co-founded by Eugene Volokh, covering legal and political issues from an ideological orientation.
Facebook Followers 4.2KTwitter Followers 22.4KInstagram Followers 588 Frequency 6 posts / day
7. LawSites RSS Feed
RSS Feed lawnext.com/feed Follow RSS Blog lawnext.com
LawSites is a blog covering legal technology and innovation. It is written by Robert Ambrogi, a lawyer, and journalist who has been writing and speaking about legal technology, legal practice, and legal ethics for more than two decades.
Frequency 1 post / day
8. Harris Bricken Sliwoski LLP | Canna Law Blog RSS Feed
RSS Feed harrisbricken.com/cannalawbl.. Follow RSS Blog harrisbricken.com
The Canna Law Blog is a forum for discussing the practical aspects of cannabis law and how it impacts those involved in this growing industry. It will provide insight into how canna businesspeople can use the law to their advantage.
Facebook Followers 163.5KTwitter Followers 5.4K Frequency 1 post / week
9. The Lawyers Corner RSS Feed
RSS Feed lawyerscorner.net/feed Follow RSS Blog lawyerscorner.net
The Lawyers Corner is a collection of local attorney blogs and current legal issues in the news. Read News, Case analysis, Legal perspectives on a number of topics covering practices from Bankruptcy, Business Laws to Worker's Compensation and Wrongful Death Laws.
Facebook Followers 869 Frequency 22 posts / year
10. fourthamendment.com RSS Feed
RSS Feed Follow RSS Blog fourthamendment.com
The website covers a wide range of topics related to the Fourth Amendment, including what the Fourth Amendment says and means, the history of the Fourth Amendment, the different types of searches and seizures that are covered by the Fourth Amendment, and more.
Frequency 13 posts / month
11. LLB Guide RSS Feed
RSS Feed llbguide.com/feed Follow RSS Blog llbguide.com
LLBguide.com is a Professional Educational Platform providing a comprehensive guide to all LLB Subjects. Here you will find easy and helpful law-related content even if you are a student or a practicing lawyer. The site creators are focused and dedicated to making laws easy to understand for everyone by providing notes with a focus on dependability.
Frequency 4 posts / month
12. Jurists Global Blog RSS Feed
RSS Feed juristsglobal.com/f.atom Follow RSS Blog juristsglobal.com
JURISTS GLOBAL'S vision is to make 'Legal access' democratic by making it neutral affordable and without boundaries. We are creating the world's first and the best 'Preventive Legal Care Ecosystem' for all and our mission is zero litigation and faster Solutions to all existing litigations in India and global justice seekers to meet their optimum need for support their interest of Global Presence.
Facebook Followers 55 Frequency 5 posts / week
13. Mugshot Arrests Blog RSS Feed
RSS Feed Follow RSS Blog remove-arrests.org
We offer a variety of services to clear your criminal record online. Our experienced internet removal experts use cutting-edge tools to identify everywhere your mugshot and arrest information shows up online. Our guaranteed mugshot removal solutions will get your mugshot and arrest record off websites and search engines like Google and Bing. We guarantee that any mugshots we remove won't be republished, protecting you from future online reputation-damage related to arrests.
Facebook Followers 998PinterestLinkedInYouTube Frequency 12 posts / day Popular Post Intelius vs. Radaris: A Comparative Review Get Contact
14. The IP Law Blog RSS Feed
RSS Feed feeds.lexblog.com/TheIpLawBlog Follow RSS Blog theiplawblog.com
The Intellectual Property Law Blog provides counsel in connection with copyrights, trademarks, patents, trade secrets, false advertising, licensing and promotions and sweepstakes. The blog's objective is to serve as a forum to discuss IP strategies that provide protection to a business' or persons' intangible assets.
Facebook Followers 315Twitter Followers 14 Frequency 2 posts / week
15. Verdict RSS Feed
RSS Feed verdict.justia.com/feed Follow RSS Blog verdict.justia.com
Legal analysis and commentary from Justia.com with the columinst team of Vikram Amar, Neil Buchanan, Sherry Colb, John Dean, Michael Dorf, Joanna Grossman, Marci Hamilton, Julie Hilden, Joanne Mariner and Anita Ramasastry.
Facebook Followers 3.3K Frequency 2 posts / week
16. FindLaw Legal Blogs RSS Feed
RSS Feed feeds.findlaw.com/LawAndLife Follow RSS Blog findlaw.com
Get the latest legal news and information, and learn more about laws that impact your everyday life with FindLaw Legal Blogs. Here, Both consumers & legal professionals can find answers, insights, and updates on legal issues.
Facebook Followers 46.3KTwitter Followers 18.1KInstagram Followers 1.4K Frequency 3 posts / quarter
17. Clio RSS Feed
RSS Feed clio.com/blog/feed Follow RSS Blog clio.com/blog
Clio was launched in 2008 by lifelong friends Jack Newton and Rian Gauvreau with the goal of transforming the practice of law for good by delivering cloud-based practice management technologies for lawyers around the world.
Facebook Followers 20KTwitter Followers 14.9KInstagram Followers 6.8K Frequency 1 post / day Since Jan 2013
18. North Carolina Criminal Law RSS Feed
RSS Feed nccriminallaw.sog.unc.edu/?f.. Follow RSS Blog nccriminallaw.sog.unc.edu
A UNC School of Government Blog. The purpose of the blog is to disseminate information about and to serve as a forum for the discussion of, North Carolina criminal law and procedure and related topics.
Twitter Followers 6.1K Frequency 1 post / day
19. Mondaq RSS Feed
RSS Feed mondaq.com/Company/Rss?monda.. Follow RSS Blog mondaq.com
Get the latest insights on Employment & HR, Real Estate & Construction, Criminal Law, Immigration, Intellectual Property, Tax, Government, Finance, and Banking. Mondaq is an intelligent syndication platform providing world-class content & insight from professional services firms.
Facebook Followers 115Twitter Followers 4.5K Frequency 30 posts / day
20. Need-to-Know News, Insights, & Intelligence for Business Leaders | JD Supra RSS Feed
RSS Feed Follow RSS Blog jdsupra.com
JD Supra is a daily source of legal intelligence on all topics business and personal, distributing news, commentary & analysis from leading lawyers & law firms.
Frequency 1 post / week
21. Law360 RSS Feed
RSS Feed Follow RSS Blog law360.com
News and analysis on legal developments including litigation filings, case settlements, verdicts, regulation, enforcement, legislation, corporate deals, and business of law. Law360, is a one-stop source for legal news and analysis, with up-to-the-minute coverage of litigation, regulation and enforcement, legislation, executive orders, administrative hearings, corporate deal-making, and more.
Facebook Followers 6.1K Frequency 28 posts / month
22. LegalMatch RSS Feed
RSS Feed lawblog.legalmatch.com/feed Follow RSS Blog lawblog.legalmatch.com
LegalMatch presents legal commentary on important events and ideas related to politics, society, and the law. Key topics covered are Criminal Defense, Real Estate, Immigration, Business, Personal Injury, and Government. LegalMatch is America's original attorney/client matching service.
Facebook Followers 6.9KTwitter Followers 1.7K Frequency 2 posts / week
23. Jonathan Turley Blog RSS Feed
RSS Feed jonathanturley.org/feed Follow RSS Blog jonathanturley.org
Prof. Jonathan Turley is a nationally recognized legal scholar who has written extensively in areas ranging from constitutional law to legal theory & tort law. He writes about Constitutional Law, Environment, Free Speech, Lawyering, Politics, Religion, Supreme Court, and more.
Twitter Followers 236.4K Frequency 2 posts / day Since Aug 2007
24. How Appealing RSS Feed
RSS Feed howappealing.abovethelaw.com.. Follow RSS Blog howappealing.abovethelaw.com
How Appealing takes a behind-the-scenes look at the world of law. The site provides news and insights about the profession's most colorful personalities and powerful institutions, as well as original commentary on breaking legal developments.
Frequency 6 posts / day
25. The Law Society RSS Feed
RSS Feed Follow RSS Blog lawsociety.org.uk
The Law Society is the voice of solicitors, driving excellence in the profession and safeguarding the rule of law. The Law Society blog showcases work from around the organization & views from across the legal sector. Key topics covered are Public Law, Banking & Finance, Civil Litigation, Criminal Justice, Cybersecurity, GDPR, Immigration, and Social Welfare.
Facebook Followers 21KTwitter Followers 120.8KInstagram Followers 19.5K Frequency 3 posts / month
26. Lawctopus RSS Feed
RSS Feed lawctopus.com/feed Follow RSS Blog lawctopus.com
A source for law students in India. We house internship experiences of law students, articles on career advice, call for papers, essay competitions, and more.
Facebook Followers 53.3KTwitter Followers 16.8KInstagram Followers 42.6K Frequency 14 posts / day Since Sep 2010
27. Patently-O RSS Feed
RSS Feed patentlyo.com/feed Follow RSS Blog patentlyo.com
Patently-O, written by Dennis Crouch, is the nation's leading patent law blog. Read it for patent prosecution tips for attorneys & inventors, statistics, and status updates of patent infringement cases. Dennis Crouch is the associate professor of law & a longtime advocate for the patent system.
Twitter Followers 16.4K Frequency 5 posts / week
28. Jurist RSS Feed
RSS Feed jurist.org/news/feed Follow RSS Blog jurist.org
Jurist is the world's only law school-based legal news and commentary service. JURIST covers legal news stories based on their substantive importance rather than on their mass-market or commercial appeal.
Facebook Followers 17.4KInstagram Followers 1.7K Frequency 11 posts / day
29. Attorney at Work RSS Feed
RSS Feed attorneyatwork.com/feed Follow RSS Blog attorneyatwork.com
Daily practice tips on practice management, marketing & rainmaking, tech, and wellness for lawyers and legal professionals. Attorney at Work is a member of the ABA Journal BLAWG 100 Hall of Fame.
Facebook Followers 2.3K Frequency 1 post / day
30. Law & Liberty RSS Feed
RSS Feed lawliberty.org/feed Follow RSS Blog lawliberty.org
Law & Liberty's focus is on the classical liberal tradition of law & political thought and how it shapes a society of free & responsible persons. This site brings together serious debate, commentary, essays, book reviews, interviews, and educational material in a commitment to the first principles of law in a free society.
Facebook Followers 46.6KTwitter Followers 8.1K Frequency 2 posts / day
31. Lawyer Monthly RSS Feed
RSS Feed lawyer-monthly.com/feed Follow RSS Blog lawyer-monthly.com
Lawyer Monthly is a legal news publication featuring the latest law news, deals, appointments, and expert insights from legal professionals around the globe.
Facebook Followers 32KTwitter Followers 8.1KInstagram Followers 3K Frequency 8 posts / week
32. Lex Blog » Southern California Bankruptcy Law Blog RSS Feed
RSS Feed lexblog.com/feed Follow RSS Blog lexblog.com
Full-service blog platform Includes custom design, hosting, coaching, SEO, free support, and syndication to the world's largest law blog network. A global blogging community bringing together many of the best legal minds on the web. We provide the industry's best tools, strategy, training and support for lawyers and law firms to engage with potential and current clients.
Facebook Followers 988Twitter Followers 18.1K Frequency 23 posts / day
33. Legal Reader RSS Feed
RSS Feed legalreader.com/feed Follow RSS Blog legalreader.com
Legal Reader is devoted to protecting consumers. It provides the latest news and commentary on legal matters ranging from automotive safety to pharmaceuticals and medical malpractice.
Facebook Followers 764Twitter Followers 652 Frequency 8 posts / day
34. Legal Desire RSS Feed
RSS Feed legaldesire.com/feed Follow RSS Blog legaldesire.com
Legal Desire is a global leading legal industry updates & insights publisher in almost every practice area of Law. We cover the latest legal law news, supreme court, high court judgments, interviews, internships, a career in law, law school events, law school notes, etc.
Facebook Followers 88.6KTwitter Followers 919Instagram Followers 2K Frequency 4 posts / day
35. LawFuel RSS Feed
RSS Feed lawfuel.com/feed Follow RSS Blog lawfuel.com
LawFuel is one of the first law news 'curation' websites, providing information about - and for - lawyers, their firms, and what they are doing in terms of careers, law marketing, law technology. Published by John Bowie, LawFuel is based in New Zealand.
Facebook Followers 970Twitter Followers 2.3K Frequency 30 posts / month
36. Attorney at Law Magazine RSS Feed
More images RSS Feed attorneyatlawmagazine.com/feed Follow RSS Blog attorneyatlawmagazine.com
Since 2007, Attorney at Law Magazine has been published in local markets nationwide. Today, its online presence has expanded it to be a publication for lawyers and legal professionals as well as a resource for legal consumers. Beyond sharing informative articles and trending op-eds, Attorney at Law Magazine also spotlights the standout lawyers in the industry. With over 10 million magazines printed, Attorney at Law Magazine has the power of a print and digital publication.
Facebook Followers 3.8KTwitter Followers 999Instagram Followers 2.6KLinkedIn Frequency 6 posts / day Get Contact
37. Asia Law Portal RSS Feed
RSS Feed asialawportal.com/feed Follow RSS Blog asialawportal.com
A forum for the news, information & opportunity in the Asia-Pacific legal markets. Topics covered are Asia Legal News, Arbitration In Asia, Featured Lawyers, Legal Entrepreneurs, Legal Recruitments, Legal Tech, and Social Media for Lawyers.
Facebook Followers 3KTwitter Followers 19.4K Frequency 2 posts / week Since Jul 2020
38. Alqada RSS Feed
RSS Feed Follow RSS Blog alqada.ae
blog post, articles related to law and regulations in Dubai, based on latest updates across UAE. Alqada is a Dubai-based legal claim collection agency that provides claims collection services to individuals and corporates.
Facebook Followers 154Instagram Followers 994 Frequency 10 posts / day
39. Harris Bricken China Law Blog RSS Feed
RSS Feed chinalawblog.com/feed Follow RSS Blog harrisbricken.com
A blog all about the business of China law & the law of China business. You'll get to learn how Chinese laws impact businesses in China. Harris Bricken is a boutique international law firm, offers specialized legal assistance to businesses that operate internationally.
Facebook Followers 24KTwitter Followers 848 Frequency 1 post / day Since Jan 2006
40. Technology & Marketing Law RSS Feed
RSS Feed blog.ericgoldman.org/feed Follow RSS Blog blog.ericgoldman.org
Technology & Marketing Law Blog by Eric Goldman provides readers with information on different laws related to technology and marketing. Key Topics covered are Adware/Spyware, Content Regulation, Copyright, Derivative Liability, Evidence/Discovery, and Trade Secrets.
Twitter Followers 14.7K Frequency 1 post / day Since Feb 2005
41. Artificial Lawyer RSS Feed
RSS Feed artificiallawyer.com/feed Follow RSS Blog artificiallawyer.com
Artificial Lawyer is all about changing the business of law, often through the use of technology, but also through the better deployment of people inside organizations and within new business structures, as well as innovation around process improvement. At the heart of this is a focus on the economic aspects of the law and the related areas of efficiency in the production of legal work, and the increased insight into the data that is produced by all legal activity and how that insight, in turn, adds new value to legal work and helps drive efficiency.
Twitter Followers 11.7K Frequency 1 post / month
42. LexForti Legal News & Journal RSS Feed
RSS Feed lexforti.com/legal-news/feed Follow RSS Blog lexforti.com
Offers access to a wide array of legal knowledge through the Daily Legal News segment of our Website. LexForti Legal News & Journal contains a vast assortment of resources that helps in understanding contemporary legal issues.
Facebook Followers 2.4KInstagram Followers 8.5K Frequency 1 post / quarter
43. Law In Sport RSS Feed
RSS Feed lawinsport.com/feed/rss/arti.. Follow RSS Blog lawinsport.com
A leading online international sports law publication providing expert commentary & analysis on the latest issues & legal developments in the world of sport. We publish articles of legal opinion, blogs, videos, and podcasts by those working in the field.
Facebook Followers 1.7KTwitter Followers 17.5K Frequency 1 post / week
44. Intelligize Blog RSS Feed
RSS Feed intelligize.com/blog/feed Follow RSS Blog intelligize.com
Covers a range of topics including Accounting, ESG, Investor Relations, IPO, M&A, News, Risk Factors, Rules & Regs, and SEC. Stay up to date with news & information from Intelligize, the leading provider in regulatory insights & tools for compliance.
Twitter Followers 437 Frequency 1 post / week Since Jan 2017
45. Michigan Auto Law RSS Feed
RSS Feed michiganautolaw.com/feed Follow RSS Blog michiganautolaw.com
A blog covering updates on changes in the auto law of the state. Articles are in the categories of Injuries, News, Car Insurance, Auto Safety, Attorney Resources, and Accidents. Michigan Auto Law helps people injured in car, truck, and motorcycle accidents throughout the state.
Facebook Followers 6KTwitter Followers 2.3KInstagram Followers 383 Frequency 13 posts / quarter
46. European Law Blog RSS Feed
RSS Feed europeanlawblog.eu/feed Follow RSS Blog europeanlawblog.eu
The European Law Blog is written by experienced and young academics, as well as practitioners from around the globe. Our ambition is to provide a range of interesting analyses of and ideas on EU law. The blog aims at highlighting and commenting on current developments in EU case law and legislation, but will also discuss new relevant legal literature.
Twitter Followers 6.2K Frequency 2 posts / week Since Jan 2012
47. Lowering the Bar RSS Feed
RSS Feed loweringthebar.net/feed Follow RSS Blog loweringthebar.net
Lowering the Bar is in all seriousness a registered trademark of Kevin Underhill. It is written by Kevin Underhill, who is solely responsible for its content.
Frequency 1 post / week
48. Davidson & Co Legal Consultants RSS Feed
RSS Feed davidsoncolaw.com/feed Follow RSS Blog davidsoncolaw.com
Blog posts cover Legal Updates, Corporate/Commercial, Employment, Economy, Federal Law, Dispute Resolution, Banking & Finance, and Davidson & Co Updates. Davidson & Co is a boutique law firm with offices in Dubai and Geneva, specializing in providing uniquely commercial legal advice.
Facebook Followers 198Twitter Followers 985 Frequency 1 post / week
49. Nonprofit Law Blog RSS Feed
RSS Feed Follow RSS Blog nonprofitlawblog.com
Gene Takagi is the managing attorney of NEO Law Group, contributing publisher of the Nonprofit Law Blog, and a regular contributor to Tony Martignetti Nonprofit Radio. At NEO, Gene has represented over 500 nonprofit organizations on corporate, tax, and charitable trust law matters. Gene is a popular writer on nonprofit legal topics and has been published by The New York Times, The Nonprofit Quarterly, The Chronicle of Philanthropy, The Nonprofit Times, Taxation of Exempts, EO Tax Journal, and ALI-ABA.
Frequency 2 posts / week
50. KJK RSS Feed
RSS Feed kjk.com/feed Follow RSS Blog kjk.com
Covers news related general to all businesses such as Corporate Law, Labor & Employment and Tax Law, and has categories tailored to specific industries, such as Esports & Entertainment, Construction & Trades, Real Estate, Health Care and more. KJK is an Ohio law firm serving businesses nationwide.
Facebook Followers 344Twitter Followers 219 Frequency 2 posts / week
51. Broadcast Law Blog RSS Feed
RSS Feed broadcastlawblog.com/feed Follow RSS Blog broadcastlawblog.com
Broadcast Law Blog by David Oxenford of Wilkinson Barker Knauer LLP addresses FCC, copyright, advertising, and other legal issues of importance to radio & television broadcasters and other media companies.
Twitter Followers 1.1K Frequency 1 post / week
52. My Shingle RSS Feed
RSS Feed feeds.feedburner.com/MyShingle1 Follow RSS Blog myshingle.com
A comprehensive online resource for solo & small firm lawyers with thousands of blog posts and an impressive stock of free e-books, checklists, and forms on starting and running a law firm. MyShingle was created to address the unmet demands and desires of solos and small law firms. Authored by Carolyn Elefant.
Twitter Followers 13.8K Frequency 1 post / week
53. Diamond and Diamond Lawyers Blog RSS Feed
RSS Feed diamondlaw.ca/feed Follow RSS Blog diamondlaw.ca
Diamond and Diamond Lawyers is a personal injury law firm founded in 2005 in Ontario, Canada. The firm's mission is to provide compassionate and effective legal support for their clients and to ensure they receive fair compensation for their losses. The Diamond and Diamond Lawyers Blog offers helpful tips and resources.
Facebook Followers 4.3K Frequency 2 posts / month
54. Center For Art Law RSS Feed
RSS Feed itsartlaw.org/feed Follow RSS Blog itsartlaw.org
The Center for Art Law is a nonprofit organization that conducts research and offers resources & programming for the advancement of a vibrant arts & law community. Here, you'll get articles on Art Law, Book Reviews, Case Reviews, and Cultural Heritage.
Facebook Followers 2.3KTwitter Followers 3.2KInstagram Followers 4.4K Frequency 3 posts / month Since Apr 2013
55. BeSpacific RSS Feed
RSS Feed bespacific.com/feed Follow RSS Blog bespacific.com
Sabrina I. Pacifici is the solo Author/Researcher of beSpacific, launched in 2002, providing accurate, focused research and knowledge discovery, highlighting primary, actionable resources from around the world. Sabrina is a founding member of the online legal and special libraries research communities, and an entrepreneurial, experienced editor, publisher, blogger, educator, web developer, and expert subject matter researcher.
Facebook Followers 187 Frequency 4 posts / day
56. The Court RSS Feed
RSS Feed thecourt.ca/feed Follow RSS Blog thecourt.ca
An online resource for debate & data about the Supreme Court of Canada. The goal is to be an inclusive forum for academics, practitioners, and interested citizens to publish, review & discuss commentary on recent Supreme Court judgments, upcoming cases, current hearings, scholarly perspectives, practical insights, updates, and more.
Facebook Followers 1.1KTwitter Followers 5.8K Frequency 1 post / week Since Jan 2007
57. :: Ghana Law Hub RSS Feed
RSS Feed ghanalawhub.com/feed Follow RSS Blog ghanalawhub.com
Ghana Law Hub exists to create and encourage the creation of timely, relevant and authentic Ghanaian legal resources. To this end, the Hub aims at detailing key and major events and developments in the legal arena from as many perspectives as possible.
Facebook Followers 10.6K Frequency 2 posts / month Since Apr 2017
58. Patrick Daniel Law RSS Feed
RSS Feed patrickdaniellaw.com/feed Follow RSS Blog patrickdaniellaw.com
Patrick Daniel Law is based in Houston, TX and has experience in Agricultural Injury, Maritime Law, Medical Malpractice, Defective Product Lawsuits, Automobile and Trucking Accident Litigation and Various other types of personal injury actions.
Facebook Followers 827Twitter Followers 3KInstagram Followers 19.7K Frequency 1 post / day
59. Probate Stars RSS Feed
RSS Feed probatestars.com/feed Follow RSS Blog probatestars.com
Probate Stars is the most comprehensive collection of information about probate, trusts, estate planning, guardianships, and inheritance litigation on the web. We provide a platform to connect people with legal problems with qualified lawyers in their region.
Facebook Followers 35 Frequency 5 posts / week
60. KnowLaw RSS Feed
RSS Feed knowlaw.in/index.php/feed Follow RSS Blog knowlaw.in
KnowLaw stands as a pioneering educational platform, dedicated to serving law aspirants, students, and mentors. Its unwavering mission revolves around providing accessible and engaging resources, enhancing the legal education experience for everyone in the legal fraternity.
Facebook Followers 108Instagram Followers 2.1K Frequency 1 post / month Since Feb 2020
61. Frost Law News RSS Feed
RSS Feed Follow RSS Blog askfrost.com
Articles feature insights and tips for Tax Law, Business Law, Bankruptcy Law & Estate Law trends. Frost & Associates, LLC is comprised of dedicated tax attorneys and other tax professionals navigating the toughest international and domestic tax issues.
Facebook Followers 1.5K Frequency 3 posts / week
62. The Malaysian Lawyer RSS Feed
RSS Feed themalaysianlawyer.com/feed Follow RSS Blog themalaysianlawyer.com
The Malaysian Lawyer is a collaborative blog by two lawyers, Lee Shih & Marcus van Geyzel. We set out updates on certain areas of Malaysian law. Key topics covered are company law, corporate rescue, insolvency, judicial management, restructuring, and more.
Frequency 2 posts / quarter Since Oct 2015
63. Kluwer Competition Law Blog RSS Feed
RSS Feed feeds.feedburner.com/Kluw.. Follow RSS Blog competitionlawblog.kluwercompetitionlaw.com
Covers Antitrust, Abuse of Dominance, Brexit, Cartels, Competition Law, Consumer Welfare, European Commission, Mergers, and Investigations. Wolters Kluwer empowers professionals with the essential information & support they need to make through with confidence on critical decisions they face daily.
Facebook Followers 32.3KTwitter Followers 17K Frequency 4 posts / week
64. Parker Poe RSS Feed
RSS Feed Follow RSS Blog parkerpoe.com
Stay up on Parker Poe's latest news & insights, client alerts, outside publications, and media mentions. Parker Poe represents Southeast's largest companies and local governments in transactions, regulatory issues, and complex litigation.
Facebook Followers 745Twitter Followers 1.2K Frequency 16 posts / month
65. Vanguard Law Magazine RSS Feed
RSS Feed Follow RSS Blog vanguardlawmag.com
Vanguard is a digital publication that showcases the incredible diversity of the modern in-house counsel, highlighting the philosophies, strategies, and initiatives of attorneys from around the world. Vanguard takes a deep dive into these complex and ever-evolving roles, giving you, the reader, an inside look at how some of the world's biggest companies navigate shifting legal terrain.
Facebook Followers 359 Frequency 3 posts / month
66. ACC Docket RSS Feed
RSS Feed Follow RSS Blog accdocket.com
The award-winning ACC Docket features articles written by in-house counsel, for in-house counsel. Articles cover Compliance & Ethics, Diversity & Inclusion, Information Governance, Environmental, Dispute Resolution, and Law Dept Management.
Facebook Followers 5.1KTwitter Followers 1.7K Frequency 7 posts / month
67. IRS Streamlined Filing Compliance Blog RSS Feed
RSS Feed irsstreamlinedprocedures.com.. Follow RSS Blog irsstreamlinedprocedures.com
An International Tax Blog featuring the latest articles, news & updates. We are International Tax Lawyers for Taxpayers worldwide.
Frequency 2 posts / month
68. Constitutional Law Reporter RSS Feed
RSS Feed constitutionallawreporter.co.. Follow RSS Blog constitutionallawreporter.com
The Constitutional Law Reporter is fully dedicated to offering everything on Constitutional Law. The site features the full constitution, every Supreme Court case, and much more.
Facebook Followers 1.9KTwitter Followers 7.5K Frequency 1 post / month
69. Canadian Labour and Employment Law RSS Feed
RSS Feed labourandemploymentlaw.com/feed Follow RSS Blog labourandemploymentlaw.com
Baker & McKenzie's Canadian Labour and Employment Law blog provides employers with up to date information on legal developments that impact workplace policies and procedures, human resources management, employment agreements, discipline and dismissal, and employment-related litigation.
Facebook Followers 23.9K Frequency 1 post / week
70. The Sam Bernstein Law Firm RSS Feed
RSS Feed callsam.com/feed Follow RSS Blog callsam.com/blog
Blog features Articles on Vehicle Accidents, Serious Injuries, Medical Issues, and more. The Sam Bernstein Law Firm is a personal injury law firm that provides legal help to accident victims across the state of Michigan.
Facebook Followers 35KTwitter Followers 1.2K Frequency 9 posts / quarter
71. Legal Mosaic RSS Feed
RSS Feed legalmosaic.com/feed Follow RSS Blog legalmosaic.com
A fit-for-purpose legal function meets the needs of the enterprise, its customers, society, and the planet. This requires a reassessment of its role from the customer perspective and a reimagination of how law can more effectively utilize existing tools, resources, data, organizational models, and metrics to achieve customer objectives. This is the crux of what I do my writing, speaking, consulting, and teaching across five continents.
Frequency 5 posts / year
72. TechnoLlama RSS Feed
RSS Feed feeds2.feedburner.com/Techno.. Follow RSS Blog technollama.co.uk
Covers several Cyberlaw topics, with emphasis on open licensing, digital rights, software protection, virtual worlds, and llamas. Authored by Dr. Andres Guadamuz, a Senior Lecturer in Intellectual Property Law at the University of Sussex.
Facebook Followers 328Twitter Followers 7KInstagram Followers 341 Frequency 1 post / month
73. Sandberg Phoenix | Employer Law Blog RSS Feed
RSS Feed sandbergphoenix.com/perspect.. Follow RSS Blog sandbergphoenix.com
Employer Law Blog has been helping business people navigate employment law. Recognizing that every business with employees faces challenges that can impact their growth and profitability, Sandberg Phoenix attorneys are committed to sharing their knowledge of, experience with and passion for employment law.
Facebook Followers 628Twitter Followers 311 Frequency 1 post / week
74. Seyfarth | California Peculiarities Employment Law Blog RSS Feed
RSS Feed calpeculiarities.com/feed Follow RSS Blog calpeculiarities.com
California Peculiarities Employment Law Blog covers legislative updates & commentary on employer laws in CA including harassment & wage statements. The Seyfarth California Peculiarities Employment Law Blog is a unique - and peculiarities - of California employment law. This blog is for in-house attorneys, HR professionals, business owners, and managers who face real issues on a daily basis and need practical solutions to address them.
Facebook Followers 990Twitter Followers 10K Frequency 1 post / month
75. DRDN Law RSS Feed
RSS Feed drdn-law.com/feed Follow RSS Blog drdn-law.com
DRDN Law is a law blog that covers topics including, attorney, bankruptcy, divorce, law, lawyer, legal service, personal injury and more.
Frequency 1 post / week
76. Simple Justice RSS Feed
RSS Feed blog.simplejustice.us/feed Follow RSS Blog blog.simplejustice.us
Scott Greenfield provides legal advice on various criminal defense cases. Learned over the years, and from the experience one gains fighting in the trenches, Scott has proven both before trial juries and appellate judges that cases can be fought and won. For more than 30 years, Scott Greenfield has represented clients charged with crimes or the targets of investigations in state and federal courts across the United States.
Twitter Followers 18.9K Frequency 1 post / day
77. Acumen Law Corporation RSS Feed
RSS Feed vancouvercriminallaw.com/fee.. Follow RSS Blog vancouvercriminallaw.com
Blog of Acumen Law Corporation dealing mainly with IRP DUI law & developments in drunk driving law. Acumen Law Corporation is a Vancouver Criminal Law Firm that helps people who are facing criminal charges, DUI or driving prohibitions in British Columbia, Canada.
Facebook Followers 1.3KTwitter Followers 3K Frequency 1 post / week
78. Cohn Legal, PLLC RSS Feed
RSS Feed cohnlg.com/feed Follow RSS Blog cohnlg.com
Our goal is to provide our clients with exceptional legal guidance and support at cost-effective rates. While excellence in legal representation is a given, we take greater pride in our ability to forge lasting bonds with our clients.
Frequency 1 post / week
79. Talk Left RSS Feed
RSS Feed talkleft.com/index.xml Follow RSS Blog talkleft.com
Provides liberal coverage of crime-related political and injustice news. TalkLeft was created by Jeralyn Merritt in 2000 as a companion site to CrimeLynx, the criminal defense practitioner's Guide to the Internet.
Facebook Followers 760Twitter Followers 823 Frequency 1 post / week
80. SeiferFlatow RSS Feed
RSS Feed seiferflatowlaw.com/feed Follow RSS Blog seiferflatowlaw.com
Keep up with articles from SeiferFlatow.
Twitter Followers 662Instagram Followers 437 Frequency 1 post / month
81. iPhone J.D. RSS Feed
RSS Feed iphonejd.com/iphone_jd/index.. Follow RSS Blog iphonejd.com
iPhone J.D. is the oldest and largest website for lawyers using iPhones and iPads. Published by Jeff Richardson, an attorney in New Orleans, Louisiana.
Twitter Followers 2.2K Frequency 3 posts / week
82. FizzLaw.com RSS Feed
RSS Feed fizzlaw.com/news/feed Follow RSS Blog fizzlaw.com/news
FizzLaw is an attorney blog (blawg) platform that enables lawyers & legal professionals to publish legal content. Our lawyer guest blogging platform is incredibly easy to manage and intuitive, making it easy to publish a legal article on topics that are relevant to your practice.
Frequency 2 posts / week
83. Legal Planet RSS Feed
RSS Feed legal-planet.org/feed Follow RSS Blog legal-planet.org
Legal Planet provides insight and analysis on energy and environmental law. Our goal is to fill a unique space in the blogosphere. We write about court decisions, regulatory actions, and state and legislation that affect climate change policy, water resource management, toxic waste disposal, renewable energy, air quality, land use, and more.
Twitter Followers 2.1K Frequency 1 post / day Since Jan 2009
84. BC Injury Law and ICBC Claims Blog RSS Feed
RSS Feed feeds.feedburner.com/IcbcLaw Follow RSS Blog bc-injury-law.com
This Blog is authored by British Columbia ICBC injury claims lawyer Erik Magraken. Erik is a partner with the British Columbia personal injury law-firm MacIsaac & Company. Follow to get informed about the latest developments in matters concerning BC personal injury claims and ICBC claims.
Facebook Followers 170Twitter Followers 6K Frequency 3 posts / month
85. Futeral & Nelson LLC RSS Feed
RSS Feed charlestonlaw.net/feed Follow RSS Blog charlestonlaw.net
Covers articles answering questions about South Carolina's family laws, South Carolina's DUI laws, South Carolina's criminal laws, and South Carolina's injury laws.
Facebook Followers 1.7KTwitter Followers 1.1K Frequency 1 post / week
86. Gravel2Gavel Construction Law Blog RSS Feed
RSS Feed gravel2gavel.com/feed Follow RSS Blog gravel2gavel.com
Gravel2Gravel, a Pillsbury blog, brings you breaking news and analysis covering a wide range of business and legal issues affecting the construction industry. It is Published by Construction Law Attorneys Pillsbury Winthrop Shaw Pittman LLP.
Twitter Followers 2.5K Frequency 1 post / week
87. Kean Miller LLP Blog RSS Feed
RSS Feed louisianalawblog.com/feed Follow RSS Blog louisianalawblog.com
Insight and Information on Louisiana law, litigation, and legal culture. Kean Miller LLP serves as legal counsel to the people and industries that drive the regional economy and provide efficient and effective legal services in a cost-efficient manner.
Facebook Followers 1.3KTwitter Followers 400 Frequency 2 posts / month
88. UK Constitutional Law Association RSS Feed
RSS Feed ukconstitutionallaw.org/feed Follow RSS Blog ukconstitutionallaw.org
The Association The United Kingdom Constitutional Law Association (UKCLA) is the UK's national body of constitutional law scholars affiliated with the International Association of Constitutional Law. Its object is to 'encourage the advancement of knowledge relating to United Kingdom constitutional law & the study of constitutions generally'.
Twitter Followers 6.6K Frequency 1 post / week
89. Foley Hoag | Trademark & Copyright Law RSS Feed
RSS Feed trademarkandcopyrightlawblog.. Follow RSS Blog trademarkandcopyrightlawblog.com
Perspectives & Legal developments in Trademarks, Copyrights, Domain Disputes, Unfair Competition, and more. Some sub-topics cover Criminal Liability, Defamation, Right of Publicity, Privacy, and Licensing. Authored by Lawyers of Foley Hoag Law Firm.
Facebook Followers 798Twitter Followers 3.3K Frequency 1 post / month Since Mar 2010
90. Minick Law Blog RSS Feed
RSS Feed minicklaw.com/feed Follow RSS Blog minicklaw.com
Minick Law's Legal Blog attempts to address common questions, to help you in your search for answers and general information about the legal process.
Facebook Followers 160Twitter Followers 35 Frequency 1 post / week
91. Global IP & Privacy Law RSS Feed
RSS Feed iptechblog.com/feed Follow RSS Blog iptechblog.com
A source for news & insights into international legal issues involving intellectual property & technology such as trademark & brand protection, patent prosecution & protection; trade secrets, data protection & privacy; and advertising & media issues. Brought to by Intellectual property & technology attorneys at Squire Patton Boggs.
Facebook Followers 3.2KTwitter Followers 11.8KInstagram Followers 3.2K Frequency 1 post / week Since Oct 2013
92. Top Legal Firm RSS Feed
RSS Feed toplegalfirm.org/feed Follow RSS Blog toplegalfirm.org
In this blog, you will find the latest articles, news, and updates on various categories of law, such as, CRIMINAL DEFENSE, DIVORCE & FAMILY LAW, ESTATE PLANNING, Traffic Ticket, Workers' Compensation, and much more. Follow the blog to know more.
Frequency 1 post / week Since Jul 2020
93. The Sheppard Mullin Labor & Employment Law Blog RSS Feed
RSS Feed feeds.lexblog.com/laboremplo.. Follow RSS Blog laboremploymentlawblog.com
The Sheppard Mullin Labor & Employment Law Blog is designed to provide employers breaking news, insights & legal analysis on issues facing employers today. Key topics covered are Antitrust, Cannabis Law, Corporate Governance, Employee Benefits, FEHA, Immigration, Retaliation, and Workers Compensation.
Facebook Followers 1.4KTwitter Followers 3.6K Frequency 1 post / week
94. Bressler Risk Blog RSS Feed
RSS Feed bresslerriskblog.com/feed Follow RSS Blog bresslerriskblog.com
Focusing on law firm risk management: trends, challenges, conflicts, compliance, technology, information security, ethics & more.
Twitter Followers 34 Frequency 1 post / day
95. JCA Law Office | Immigration & Family Law RSS Feed
RSS Feed filipinolawyer.ca/feed Follow RSS Blog filipinolawyer.ca
JCA Law Office provides assistance on Filipino Immigration, Real Estate Closings, NBI Clearance, NSO certificates, and other legal services.
Facebook Followers 8.1KTwitter Followers 40 Frequency 1 post / day
96. Customs & International Trade Law Blog RSS Feed
RSS Feed customsandinternationaltrade.. Follow RSS Blog customsandinternationaltradelaw.com
Keep up with the latest news & updates on Customs and International Trade Law. Key topics covered are AD/CVD, CBTPA, China Trade War, Currency Seizure, Defense Production Act, Labor Rights, and Trade Policy. Authored by Jennifer Diaz. International trade involves numerous complex laws, regulations, policies and procedures. Our team of attorneys has extensive experience in the legal issues governing customs law, international trade law, food and cosmetics law, product licensing and related intellectual property issues.
Facebook Followers 995Twitter Followers 778Instagram Followers 307 Frequency 1 post / week
97. Leading As Lawyers RSS Feed
RSS Feed leadingaslawyers.blog/feed Follow RSS Blog leadingaslawyers.blog
A Place for the Discussion of Leadership and Leadership Development for Lawyers, Law Students and Legal Educators
Frequency 3 posts / month
98. Seyfarth | Workplace Class Action Blog RSS Feed
RSS Feed workplaceclassaction.com/feed Follow RSS Blog workplaceclassaction.com
Workplace Class Action Blog is devoted to the needs of corporate employers confronting the challenges of complex workplace litigation. Our team of bloggers at Seyfarth are complex workplace litigation practitioners who provide advisory, litigation, and transactional legal services.
Facebook Followers 981Twitter Followers 1.2K Frequency 2 posts / week
99. The McKinney Law Firm RSS Feed
RSS Feed themckinneylawfirm.com/texas.. Follow RSS Blog themckinneylawfirm.com
Covers issues and developments in federal and Texas employment law, including wrongful termination, sexual harassment, discrimination, and retaliation news and cases. McKinney Law Firm is a firm that focuses on the most serious Employment Rights & Workplace Injury cases.
Twitter Followers 2.8K Frequency 1 post / month
100. The Last Word RSS Feed
RSS Feed rudrajyotinathray.com/feed Follow RSS Blog rudrajyotinathray.com
The Last Word' seeks to include not only wise and witty sayings of the judges but also curiosities of lawyers and the law. This blog is not of obligation but of delight. I frankly confess my ignorance of much that ought to be included from overseas jurisdictions, and I utter a gentle prayer that those who know better would lighten my darkness.
Frequency 1 post / week Since Dec 2014
101. The Law Offices of Gary I. Handin RSS Feed
RSS Feed handinlaw.com/feed Follow RSS Blog handinlaw.com
Gary I. Handin, PA., is dedicated to providing exceptional legal representation to each and every client we serve. Our success has been directly linked to our proven ability to provide professional, personalized and compassionate service. Get updated on your legal knowledge with the Gary I. Handin, P.A. legal updates and news page and articles.
Frequency 2 posts / quarter
102. Koehler Law Blog RSS Feed
RSS Feed koehlerlaw.net/feed Follow RSS Blog koehlerlaw.net
Koehler Law defends people charged with criminal offenses in D.C., Arlington, and Alexandria. On the blog, author and attorney, Jamison Koehler shares stories and experiences as a Criminal lawyer. He also talks about current legal issues and high-profile public cases and engages readers in playful, entertaining yet informative ways.
Facebook Followers 91Twitter Followers 1.4K Frequency 5 posts / quarter
103. Sim & Rahman RSS Feed
RSS Feed simrahman.com/feed Follow RSS Blog simrahman.com
Sim & Rahman is a law firm in Setia Alam, Malaysia ready to serve you and provide legal advice to meet your legal needs.
Frequency 4 posts / quarter Since Oct 2020
104. Grits for Breakfast RSS Feed
RSS Feed gritsforbreakfast.blogspot.c.. Follow RSS Blog gritsforbreakfast.blogspot.com
Welcome to Texas justice: You might beat the rap, but you won't beat the ride.
Frequency 1 post / week
105. Healthcare Law Insights RSS Feed
RSS Feed healthcarelawinsights.com/feed Follow RSS Blog healthcarelawinsights.com
Healthcare Law Insights gives us an opportunity to share our expertise with a wider community. It will feature original insight and commentary on important legal issues and trends affecting healthcare organizations. Healthcare Law Insights is published by the Husch Blackwell Health Law Team and focuses on legal issues surrounding the healthcare landscape.
Instagram Followers 2.5K Frequency 1 post / day
106. Joshua Wu Kai-Ming RSS Feed
RSS Feed joshuawu.my/feed Follow RSS Blog joshuawu.my
Keep up with the articles on Law, Politics, Religion from Joshua Wu Kai-Ming.
Frequency 1 post / month
107. Law Truly RSS Feed
RSS Feed lawtruly.com/feed Follow RSS Blog lawtruly.com
Law Truly is a website dedicated to providing quality legal information to legal practitioners and others. For Lawyers, law and law practice are constantly changing making it imperative for legal practitioners to keep up with the change.
Frequency 2 posts / quarter Since Dec 2019
108. Understanding The Americans with Disabilities Act (ADA) RSS Feed
RSS Feed understandingtheada.com/feed Follow RSS Blog understandingtheada.com
ADA legal consultant William D. Goren provides consultation, legal research and writing and counsels on cases involving compliance with the Americans with Disabilities Act (ADA) and the Rehabilitation Act of 1973.
Frequency 1 post / week
109. The Texas Attorney RSS Feed
RSS Feed thetexasattorney.com/feed Follow RSS Blog thetexasattorney.com
Covers articles related to personal injuries and accidents, criminal defense, bankruptcy, family law and divorce, employment and labor law, social security and disability, and estate planning. The Texas Attorney brings four decades of hands-on experience to clients facing a wide range of legal challenges.
Facebook Followers 2Twitter Followers 2.2KInstagram Followers 1.1K Frequency 1 post / week
110. Talkov Law RSS Feed
RSS Feed talkovlaw.com/feed Follow RSS Blog talkovlaw.com
Talkov Law is dedicated to educating the public and keeping up with the latest legal developments through our blog. Our blog posts cover all of our practice areas, including real estate law, family law, bankruptcy law, business law, and trusts & probate law.
Facebook Followers 58Twitter Followers 19 Frequency 6 posts / month Since Mar 2010
111. Karl Bayer RSS Feed
RSS Feed disputingblog.com/feed Follow RSS Blog disputingblog.com
Disputing is published by Karl Bayer, a dispute resolution expert based in Austin, Texas. Articles published on Disputing aim to provide original insight and commentary around issues related to arbitration, mediation, and the alternative dispute resolution industry.
Frequency 2 posts / quarter
112. Nomos | California Construction Law Blog RSS Feed
RSS Feed calconstructionlawblog.com/feed Follow RSS Blog calconstructionlawblog.com
At Nomos LLP, we've published this blog to keep everyone informed of new developments in construction law. From contract formation to contract disputes, we have the knowledge, expertise and pragmatism to take you from groundbreaking to ribbon cutting. Here are featured articles exclusively on Construction Law.
Facebook Followers 206Twitter Followers 172 Frequency 1 post / week
113. Weintraub Tobin Blog RSS Feed
RSS Feed thelelawblog.com/feed Follow RSS Blog thelelawblog.com
The Labor and Employment Law blog is written by the Employment Lawyers at Weintraub Tobin law firm and discusses labor and employment topics, issues, and legal news. Weintraub Tobin is an innovative provider of sophisticated legal services to businesses and business owners throughout California.
Facebook Followers 448Twitter Followers 416 Frequency 1 post / week
114. Lerners Personal Injury Law Firm RSS Feed
RSS Feed lernerspersonalinjury.ca/ins.. Follow RSS Blog lernerspersonalinjury.ca
Lerners Personal Injury Law Firm blog provides updated information about personal injury law in Toronto & London, Ontario.
Facebook Followers 1.8KTwitter Followers 1.8K Frequency 1 post / quarter
115. Law 4 Small Business RSS Feed
RSS Feed feeds.feedburner.com/L4SB Follow RSS Blog l4sb.com/blog
Get insights on Business Formation, Business Support & Tips, Dispute Resolution, Employee Management, M&A, and Taxes. Law 4 Small Business (L4SB) is a law firm focused exclusively on small & medium-sized businesses in the State of New Mexico.
Facebook Followers 2KTwitter Followers 227 Frequency 1 post / week
116. Wise Law Blog RSS Feed
RSS Feed wiselaw.blogspot.com/feeds/p.. Follow RSS Blog wiselaw.blogspot.com
Legal headlines and opinions from Toronto employment lawyer, Garry J. Wise and the lawyers of Wise Law Office, Toronto, Ontario.
Facebook Followers 173Twitter Followers 2.5K Frequency 1 post / day Since Apr 2005
117. Fire Law Blog RSS Feed
RSS Feed firelawblog.com/feed Follow RSS Blog firelawblog.com
Fire Law Blog is a Fire Service and Public Safety Legal Issues Blog by Curt Varone. Curt Varone has over 40 years of fire service experience and 30 as a practicing attorney licensed in both Rhode Island and Maine.
Facebook Followers 8.1KTwitter Followers 1.5K Frequency 1 post / day
118. Stephens' Squibs RSS Feed
RSS Feed eddiestephens.com/feed Follow RSS Blog eddiestephens.com
A short concise summary of all Florida Family Law cases from 2005 - 2018 by Board Certified Divorce Attorney Eddie Stephens and selected published essays.
Facebook Followers 697Twitter Followers 422Instagram Followers 464 Frequency 2 posts / week Since Dec 2005
119. Who Is My Employee? RSS Feed
RSS Feed whoismyemployee.com/feed Follow RSS Blog whoismyemployee.com
On this website, we will explore the various legal standards used to determine Who Is My Employee? We will examine new developments, trends, changes in the law, strategies, tips, and whatever else comes to mind.
Twitter Followers 1.2K Frequency 1 post / week
120. Houston Tax Attorney Blog RSS Feed
RSS Feed irstaxtrouble.com/feed Follow RSS Blog irstaxtrouble.com
We provide IRS audit and tax debt solutions for clients nationwide. This includes settling IRS tax debts and resolving unpaid tax liabilities. Our goal is to help reduce the time, confusion, and stress associated with federal and state tax matters.
Facebook Followers 930Twitter Followers 16 Frequency 1 post / week
121. McNees | Pennsylvania Labor & Employment Blog RSS Feed
RSS Feed palaborandemploymentblog.com.. Follow RSS Blog palaborandemploymentblog.com
The McNees Labor & Employment Blog seeks to provide employers with operations in Pennsylvania with the latest updates, analysis, and commentary on how the law impacts employers at the national, state, and local level. Their attorneys cover topics including employment litigation, wage & hour issues, unions, social media, discrimination & harassment, employee benefits, and affirmative action.
Facebook Followers 694Twitter Followers 909 Frequency 2 posts / month
122. Security, Privacy And The Law RSS Feed
RSS Feed securityprivacyandthelaw.com.. Follow RSS Blog securityprivacyandthelaw.com
Security, Privacy And The Law provides legal perspectives on the expanding universe of information security and privacy issues. Foley Hoag is a law firm that represents public and private clients in a wide range of disputes and transactions worldwide.
Facebook Followers 766Twitter Followers 3.6K Frequency 1 post / month Since Oct 2008
123. Stephen Legal RSS Feed
RSS Feed stephenlegal.ng/feed Follow RSS Blog stephenlegal.ng
Stephen Legal is in the business of providing innovative legal insights and easy solution in this information age. It presents an online platform for people.
Facebook Followers 6KTwitter Followers 440 Frequency 1 post / quarter Since Oct 2016
124. Lawyer Issue RSS Feed
RSS Feed lawyerissue.com/feed Follow RSS Blog lawyerissue.com
Lawyer Issue has a highly targeted international readership and is a great tool for global professionals. We aim to provide valued insight into the legal sector and shine a spotlight on many of the trending issues.
Twitter Followers 1.8K Frequency 30 posts / year
125. Five Minute Law RSS Feed
RSS Feed fiveminutelaw.com/feed Follow RSS Blog fiveminutelaw.com
'Why do you write like you're running out of time?'
Facebook Followers 85Twitter Followers 3.7K Frequency 5 posts / year
126. A&L Goodbody LLP Blog RSS Feed
RSS Feed irelandip.com/feed Follow RSS Blog techlaw.ie
Ireland IP & Technology Law Blog provides the information you need to know about Intellectual property & technology law in Ireland. A&L Goodbody is an Irish law firm providing expert legal advice across every aspect of business law.
Facebook Followers 2.9KTwitter Followers 5K Frequency 4 posts / quarter
127. Holzfaster, Cecil, McKnight & Mues, LPA Blog RSS Feed
RSS Feed hcmmlaw.com/blog/feed Follow RSS Blog hcmmlaw.com/blog
HCMM, short for Hanni, Carmichael, Manges, and Markle, specializes in family law, covering divorce, child custody, and adoption matters. Their blog serves as a beacon of legal guidance for Ohio families grappling with challenging situations. With a commitment to providing insightful advice and information, HCMM supports families navigating through tough times with clarity and empathy.
Facebook Followers 361Twitter Followers 6.4KInstagram Followers 75 Frequency 1 post / week
128. Employment & Labor Insider Blog RSS Feed
RSS Feed constangy.com/employment-lab.. Follow RSS Blog constangy.com
The Employment & Labor Insider blog provides insight on class action litigation, employee benefits, labor relations, and compensation.
Facebook Followers 598Twitter Followers 1.4K Frequency 1 post / week
129. The Korean Law Blog RSS Feed
RSS Feed thekoreanlawblog.com/feed/atom Follow RSS Blog thekoreanlawblog.com
The Korean Law Blog is brought to you by New York Attorney Sean Hayes and the partners, associates and consultants at IPG. It is an International Law Firm Blog. Korean Civil,Criminal and Business Law explained by leading Lawyers in Korea.
Twitter Followers 664 Frequency 19 posts / quarter
130. Election Law Blog RSS Feed
RSS Feed electionlawblog.org/?feed=rss2 Follow RSS Blog electionlawblog.org
Rick Hasen's Election Law Blog explains the law of politics and the politics of law election law, campaign finance, legislation, voting rights, initiatives, redistricting, and the Supreme Court nomination process.
Facebook Followers 1.7KTwitter Followers 92.8K Frequency 10 posts / day Since Sep 2003
131. Employers' Lawyers Blog RSS Feed
RSS Feed employerslawyersblog.com/feed Follow RSS Blog employerslawyersblog.com
The Employers' Lawyers Blog offers the latest legal news and commentary on issues affecting today's employers. Their Labor and Employment team posts best practice tips, checklists and updates designed to keep organizations of all sizes in compliance with federal and state employment laws.
Twitter Followers 1.8K Frequency 1 post / week
132. D.R. PATTI & ASSOCIATES RSS Feed
RSS Feed vegaspifirm.com/index.php/feed Follow RSS Blog vegaspifirm.com
D.R. Patti & Associates are Las Vegas trial lawyers handling personal injury, medical malpractice, business, DUI, and civil rights cases.
Facebook Followers 480Twitter Followers 30 Frequency 1 post / quarter
133. Lester Aldridge Solicitors | Legal Advice and Law Firm RSS Feed
RSS Feed lesteraldridge.com/feed Follow RSS Blog lesteraldridge.com
Lester Aldridge solicitors are a full service law firm with offices in Bournemouth, Southampton & London. Outstanding private & commercial legal advice. For Lester Aldridge news, developments and new legislation, our blog has everything you'll need to know to keep you up to date.
Facebook Followers 539Twitter Followers 1.6KInstagram Followers 1.3K Frequency 1 post / day
134. Cardozo Arts & Entertainment Law Journal RSS Feed
RSS Feed cardozoaelj.com/feed/?x=1 Follow RSS Blog cardozoaelj.com
AELJ was the first and remains a preeminent journal of its type in the country. Appearing three times a year, AELJ publishes a wide variety of works concerning the First Amendment, intellectual property, entertainment, and communications law.
Facebook Followers 511Twitter Followers 919 Frequency 7 posts / quarter
135. Eloise Gratton | Privacy & IT Law RSS Feed
RSS Feed eloisegratton.com/feed Follow RSS Blog eloisegratton.com
Eloise Gratton is a lawyer practicing in Privacy and IT Law. She also teaches at the Faculty of Law, University of Montreal. She is a partner at Borden Ladner Gervais LLP and National Co-Leader of the Privacy and Data Security Practice Group. She shares the latest news and updates about Privacy and IT law on her blog.
Twitter Followers 2.6K Frequency 3 posts / quarter
136. LegalDocsA2Z RSS Feed
RSS Feed legaldocsa2z.com/feed Follow RSS Blog legaldocsa2z.com
Orange County Divorce Attorney |LegalDocsA2Z encourages Amicable divorce flat fee $599 with kids, $499 no kids, save your money and time
Facebook Followers 1.4KInstagram Followers 33 Frequency 7 posts / year
137. Inpractice | Business Development and Legal Technology for Law Firms RSS Feed
RSS Feed inpractice.co.uk/feed/rss2 Follow RSS Blog inpractice.co.uk
Enabling lawyers to plan ahead to build a smarter business that stands out. Effective, innovative and competitive.
Twitter Followers 1.1K Frequency 3 posts / year
138. ONE400 RSS Feed
RSS Feed one-400.com/feed Follow RSS Blog one-400.com/blog
ONE400 is a law innovation agency focusing on cutting edge websites and integrated marketing solutions for law firms and legal tech startups.
Facebook Followers 557Twitter Followers 2.8KInstagram Followers 360 Frequency 1 post / week
139. Labour Pains RSS Feed
RSS Feed ottawaemploymentlaw.com/feed.. Follow RSS Blog ottawaemploymentlaw.com
An employment law blog for employers and employees. Published by Sean Bawden of Kelly Santini LLP. Sean P. Bawden is an experienced trial lawyer and trusted strategic advisor with respect to matters of employment law and commercial disputes. He is a partner with Kelly Santini LLP, located in Ottawa, Ontario, Canada.
Twitter Followers 4.2K Frequency 1 post / month Since Apr 2012
140. Christensen Law Blog RSS Feed
RSS Feed davidchristensenlaw.com/feed Follow RSS Blog davidchristensenlaw.com
Auto accident blog Articles by David Christensen focusing on legal issues for car accident victims who suffer traumatic brain injury. Christensen Law is a preeminent Michigan law firm specializing in personal injury, traumatic brain injury (TBI), wrongful death, truck, car, and motorcycle accidents.
Facebook Followers 4.9KTwitter Followers 281 Frequency 23 posts / year
141. Boston Criminal Lawyer Blog | Altman & Altman LLP RSS Feed
RSS Feed bostoncriminallawyerblog.com.. Follow RSS Blog bostoncriminallawyerblog.com
Boston Criminal Lawyer Blog is published by Boston, Massachusetts Criminal Defense Attorneys, Altman and Altman. The blog provides updates on criminal cases. For over four decades, the law firm Altman and Altman, LLP has been providing outstanding criminal defence legal services to clients in Massachusetts and throughout New England. With decades of experience, their team of bright, aggressive, and hardworking criminal attorneys draw upon their broad base of expertise to provide their clients with the highest quality legal advice.
Facebook Followers 4 Frequency 2 posts / year
142. Canadian Privacy Law Blog RSS Feed
RSS Feed blog.privacylawyer.ca/feeds/.. Follow RSS Blog blog.privacylawyer.ca
Developments in privacy law and writings of a Canadian privacy lawyer, containing information related to the Personal Information Protection and Electronic Documents Act (aka PIPEDA) and other Canadian and international laws.
Twitter Followers 7.4K Frequency 4 posts / quarter Since Jan 2004
143. Pairokar RSS Feed
RSS Feed parokar.blogspot.com/feeds/p.. Follow RSS Blog parokar.blogspot.com
Regular updates and news.
Frequency 1 post / week
144. The Pink Attorney Blog RSS Feed
RSS Feed specificfeeds.com/thepinkatt.. Follow RSS Blog thepinkattorney.com
A blog tackling legal issues and life experiences with honesty, integrity and a dash of humor!
Frequency 1 post / week
145. A Winning Tip RSS Feed
RSS Feed awinningtip.blogspot.com/fee.. Follow RSS Blog awinningtip.blogspot.com
A trial consultant for more than 20 years, I am also a psychologist, author and speaker. I have had the privilege of extensively studying how people think, make decisions and how they commit to those decisions.
Frequency 1 post / quarter Since Nov 2008
146. Kuzyk Law RSS Feed
RSS Feed kuzyklaw.com/feed Follow RSS Blog kuzyklaw.com
Kuzyk Law has served Lancaster, Palmdale & all of Antelope Valley for over 40 years.
Facebook Followers 1.2KTwitter Followers 38 Frequency 3 posts / month
147. Screw You Guys, I'm Going Home RSS Feed
RSS Feed feeds.feedburner.com/Scre.. Follow RSS Blog employeeatty.blogspot.com
What You Need To Know Before You Scream 'I Quit, 'Get Fired, Or Decide to Sue the Bastards. Author Donna Ballman is an employee-side employment lawyer. She has built a reputation as a skilled and knowledgeable attorney in all of the aspects of labor and employment law. Follow to read her regular articles on employee-side employment law issues.
Facebook Followers 212Twitter Followers 6.8K Frequency 3 posts / quarter Since Oct 2010
148. Ferragut Law Firm | Criminal Defense Attorney RSS Feed
RSS Feed ferragutlaw.com/feed Follow RSS Blog ferragutlaw.com
Welcome to the Ferragut Law Firm, a top rated criminal defense attorney Phoenix Arizona, dedicated exclusively to the practice of criminal law in all state, federal, and city courts throughout the State of Arizona.
Frequency 1 post / year
149. JDJournal RSS Feed
RSS Feed jdjournal.com/feed Follow RSS Blog jdjournal.com
JD Journal provides Legal News & Law Firm News for Attorneys, Lawyers, Paralegals, Law Firm Staff, and Other Legal Professionals. For several years here at Employment Research Institute, the parent company of The JD Journal, we have thoughtfully considered the most efficient ways to address issues, concerns, and new products that are directly related to enhancing the professional lives and job-seeking efforts of attorneys, law students, and other legal staff.
Facebook Followers 153 Frequency 8 posts / day
150. The Wall Street Journal » Law-Legal RSS Feed
RSS Feed Follow RSS Blog wsj.com
Discover the latest and breaking Law news from The Wall Street Journal. The Wall Street Journal was founded in July 1889. Ever since, the Journal has led the way in chronicling the rise of industries in America and around the world. In no other period of human history has the planet witnessed changes so dramatic or swift.
Facebook Followers 7.3MInstagram Followers 4.9M
151. The Crime Report RSS Feed
RSS Feed thecrimereport.org/feed Follow RSS Blog thecrimereport.org
Your Complete Criminal Justice Resource. The Crime Report (TCR) is the nation's only comprehensive news service covering the diverse challenges and issues of 21st century criminal justice in the U.S. and abroad. TCR is a member of the Investigative News Network of online investigative journalism sites.
Facebook Followers 6.4KTwitter Followers 16.4K Frequency 17 posts / month
152. PhD Law Writers Blog RSS Feed
RSS Feed Follow RSS Blog phdlawwriters.com
The PhD Law Writers Blog covers law dissertations, law case studies, research papers, etc. These posts share writing tips for several types of law assignments. PhD Law Writers is a dedicated team of individuals that provides reliable & trustworthy assignments of law academics for students all across the country.
Instagram Followers 1.3K Frequency 12 posts / year
153. 4M Legal and Tax Law Firm RSS Feed
RSS Feed 4mlegaltax.com/feed Follow RSS Blog 4mlegaltax.com
Uncover the latest News & Insights illuminating the legal landscape. Read careful analyses, market reports, and other relevant stories. 4M Legal and Tax law firm is an experienced bilingual Law Firm in Douala, Cameroon, and offers full-service legal, regulatory, and tax solutions, bridging West and Central Africa.
Facebook Followers 23 Frequency 1 post / month
154. Reuters » Legal RSS Feed
RSS Feed Follow RSS Blog reuters.com
Reuters, the news and media division of Thomson Reuters, is the world's largest multimedia news provider, reaching billions of people worldwide every day. Reuters provides business, financial, national, and international news to professionals via desktop terminals, the world's media organizations, industry events, and directly to consumers.
Facebook Followers 7.1MInstagram Followers 4.9M
155. Rocket Lawyer Everyday Law Blog RSS Feed
RSS Feed rocketlawyer.com/blog/feed Follow RSS Blog rocketlawyer.com
Everyday Law helps you identify the ways the law can make your life better. Find tips about timely legal topics and learn how people like you manage their issues. Rocket Lawyer makes the law work for you at a price you can afford.
Facebook Followers 27.9KTwitter Followers 14.2K
156. Latham & Watkins RSS Feed
RSS Feed Follow RSS Blog lw.com
Latham & Watkins is a global law firm with more than 3,000 lawyers in its offices located in Asia, Europe, the Middle East, and the United States. The firm has internationally recognized practices in a wide spectrum of transactional, litigation, corporate and regulatory areas. Our success is grounded in our devotion to the collaborative process, which reaches across global offices and practices and draws upon our deep subject matter expertise, an abiding commitment to teamwork, and a powerful tradition of creative lawyering.
Facebook Followers 10.8KInstagram Followers 5.1K
157. The Fashion Law RSS Feed
RSS Feed thefashionlaw.com/feed Follow RSS Blog thefashionlaw.com
The Fashion Law provides well-curated, research-driven news and insights into the legal and business aspects of the rapidly evolving fashion industry. Julie Zerbo is the founder and editor-in-chief of The Fashion Law.
Facebook Followers 19.7KTwitter Followers 88.8KInstagram Followers 157K Since Jan 2014
158. The Biglaw Investor RSS Feed
RSS Feed biglawinvestor.com/feed Follow RSS Blog biglawinvestor.com
The Biglaw Investor is a finance and investing blog for smart lawyers who want to build wealth and achieve financial independence. Topics covered are Asset Protection, Financial Independence, Investing, Taxes, and Loans.
Twitter Followers 3.9KInstagram Followers 731 Frequency 1 post / month Since May 2016
159. Blumberg RSS Feed
RSS Feed blog.blumberg.com/index.php/.. Follow RSS Blog blog.blumberg.com
Serving the legal community since 1887. This blog is prepared for general information purposes to permit you to learn more about our company, our products & services, and the events affecting our business community. We cover Legal Supplies, Marketing Services, Legal Pads, Tax Information, Corporate Seals, and Publication Services.
Twitter Followers 297 Since Oct 2020
160. Dezan Shira & Associates RSS Feed
RSS Feed dezshira.com/feed Follow RSS Blog dezshira.com
Keep up with our regular insights & thought leadership regarding economic regulatory & operating conditions, upcoming events, webinars, and more. Dezan Shira & Associates is a multi-disciplinary professional services firm, providing legal, tax, and operational advisory to international corporate investors operational throughout China, ASEAN, and India.
Facebook Followers 1.4KTwitter Followers 1.4K
161. Chugh LLP News RSS Feed
RSS Feed chugh.com/feed Follow RSS Blog chugh.com
Covers Accounting, Arbitration Clause, California Law, Contract law, Data Privacy, Hotel Law, Immigration, Family Law, Tax Law, and Workplace Inspections. Chugh, LLP is a full-service Law & CPA Firm specializing in Immigration, Corporate, Taxation, Litigation, and Employment with offices in the USA & India.
Facebook Followers 12.4KTwitter Followers 7.9KInstagram Followers 650 Since May 2020
162. CL&P Blog RSS Feed
RSS Feed pubcit.typepad.com/clpblog/i.. Follow RSS Blog pubcit.typepad.com
Updates and ideas about consumer law and policy by lawyers and law professors. The blog is hosted by the Public Citizen Litigation Group.
163. Truth Legal Solicitors | Personal Injury, Medical Negligence, Immigration and Employment Law RSS Feed
RSS Feed truthlegal.com/latest-news/feed Follow RSS Blog truthlegal.com
Truth Legal pursues justice. We strive to provide the most caring, thorough and individual personal injury, employment, clinical negligence legal representation available. Truth Legal Solicitors are an ethical, tenacious and affordable law firm.
Facebook Followers 531Twitter Followers 2.1K
164. Law with Shaheen RSS Feed
RSS Feed lawwithshaheen.com/feed Follow RSS Blog lawwithshaheen.com
Learn Law To Protect Your Rights
Twitter Followers 113 Frequency 11 posts / year
165. In House Blog RSS Feed
RSS Feed Follow RSS Blog inhouseblog.com
InhouseBlog® and its job board, GoInhouse®, are owned and operated by Law Department Solutions, LLC. InhouseBlog was co-founded by Geoffrey Gussis (LinkedIn), who serves as Managing Editor, and Amar Maktal (LinkedIn), who serves as Chief Technologist. InhouseBlog® was selected as a Top 100 Blawg by the ABA Journal (2008), nominated as a Top 25 Business Law Blog by LexisNexis (2010), selected as the Runner-Up for the Best Practice Specific Blawg in Dennis Kennedy's 2011 Blawggie Awards and 2013 Blawggie Awards, and won the Best Practice Specific Blawg in those awards in 2014 and 2015.
Frequency 1 post / month
166. The Law Office of Gaynell Williams LLC Blog RSS Feed
RSS Feed gaynellwilliamslaw.com/blog-.. Follow RSS Blog gaynellwilliamslaw.com
As a New Orleans-based law firm, the experienced criminal defense lawyers at Gaynell Williams, LLC represent clients who have been arrested on misdemeanor charges, drug charges, property and theft charges, DWI/DIU charges, federal charges, and white-collar crime charges to name a few. Each criminal defense attorney in their office tailors their aggressive representation to fit each client's criminal defense needs and works with the top investigators and experts in the field to make sure that no stone is left unturned and no avenue of defense is left unexplored.
Facebook Followers 495Twitter Followers 15Instagram Followers 270 Frequency 20 posts / year
167. Legal Theory Blog RSS Feed
RSS Feed lsolum.typepad.com/legaltheo.. Follow RSS Blog lsolum.typepad.com
Blog articles focus on legal theory and its interpretation in the current era. Lawrence Solum is a Law Professor at University of Virginia, JD Harvard Law, and teaches Originalism, virtue jurisprudence, AI, normative legal theory.
Twitter Followers 9.9KInstagram Followers 1.5K Frequency 30 posts / year Since Sep 2002
168. Law And More | Deconstructing What Happens in Law RSS Feed
RSS Feed lawandmore.typepad.com/law_a.. Follow RSS Blog lawandmore.typepad.com
Jane Genova is the creator of the Law And More blog, where she deconstructing what happens in law. She helps you sell yourself to your target markets (including future employers).
169. New York Personal Injury Law Blog RSS Feed
RSS Feed feeds.feedburner.com/NewY.. Follow RSS Blog newyorkpersonalinjuryattorneyblog.com
New York Personal Injury Law Blog by Eric Turkewitz, is an attorney's blog on New York personal injury law, medical malpractice, the civil justice system and cases of interest. Eric Turkewitz has tried personal injury cases to verdict in New York, Bronx, Brooklyn, Queens, Staten Island, Nassau, Suffolk, Westchester, Rockland, Dutchess and Albany counties. He has argued appeals in the the Second Circuit Court of Appeals, Appellate Division First Department and Appellate Division Second Department.
Since Nov 2006
170. Jersey Criminal Attorneys RSS Feed
RSS Feed jerseycriminalattorney.com/feed Follow RSS Blog jerseycriminalattorney.com
New Jersey Criminal Lawyers - Dedicated to defending & protecting people charged with crimes
171. Law Office of Steven Rodemer, LLC Blog RSS Feed
RSS Feed Follow RSS Blog coloradospringscriminaldefense.net
Posts on Criminal defense, Colorado Domestic Violence Defense, Colorado Misdemeanor Defense, and generic legal information. Steven Rodemer is a Colorado Springs Criminal Defense Attorney specializing in DUI, DWAI, and domestic violence defense.
Frequency 11 posts / year
172. Donich Law | Toronto Criminal Lawyers RSS Feed
RSS Feed mydefence.ca/category/crimin.. Follow RSS Blog mydefence.ca
Toronto Law Firm providing legal solutions in Criminal Defence, Professional Regulation and Civil Litigation.
173. Law21 Blog RSS Feed
RSS Feed law21.ca/feed Follow RSS Blog law21.ca/blog
Jordan Furlong, a prominent analyst of the global legal market, offers invaluable insights into its evolution. Legal firms seek Law21 consultancy to grasp radical changes and build sustainable enterprises. Jordan advises lawyers on crafting competitive strategies to thrive in the evolving legal services landscape.
Frequency 1 post / year
174. Beyond Billables Blog RSS Feed
RSS Feed Follow RSS Blog beyondbillables.com
From marketing strategy to personal branding, social media to inspiring stories, the blog is all about free advice for anyone with the ambition to make something great of their business. Beyond Billables are branding experts for legal and professional firms and specialise in assisting law firms and professionals build valuable reputations.
Facebook Followers 3.8KInstagram Followers 4.2K Frequency 18 posts / year
175. Sentencing Law and Policy RSS Feed
RSS Feed sentencing.typepad.com/sente.. Follow RSS Blog sentencing.typepad.com
Sentencing Law and Policy blog provides information and commentary about guidelines and capital sentencing. Professor Berman is the sole creator and author of the Sentencing Law and Policy blog. Professor Berman provides consulting services on various cutting-edge federal sentencing issues. He also is frequently contacted by the media concerning sentencing developments.
Twitter Followers 4.8K Frequency 30 posts / year Since May 2004
176. Ruth Carter | Carter Law Firm RSS Feed
RSS Feed feeds.feedburner.com/CarterL.. Follow RSS Blog carterlawaz.com
Carter Law Firm provides legal services in the areas of intellectual property, social media law, business law, & flash mob law. Ruth Carter is an Arizona business attorney, Phoenix business lawyer, intellectual property, internet law - Lawyer. Author. Professional Speaker.
Facebook Followers 896Twitter Followers 2.8K
177. In-House Ops | Leading High-Performance Law Department RSS Feed
RSS Feed inhouseops.com/feed Follow RSS Blog inhouseops.com
In-House Ops is published by Law Business Media. For almost 25 years, Corporate Counsel Business Journal (formerly Metropolitan Corporate Counsel) has delivered leading-edge information to the in-house community. MCC's founder, Al Driver, former General Counsel of one of the world's leading retailers, was committed to partnering with the world's leading corporate law department leaders and outside counsel from elite law firms to deliver the essential information needed to be a successful general counsel.
Facebook Followers 214Twitter Followers 3.5K Frequency 20 posts / year Since Feb 2016
178. The Legal Satyricon RSS Feed
RSS Feed feeds.feedburner.com/TheLega.. Follow RSS Blog randazza.wordpress.com
The primary goal of Randazza Legal Group is to protect your freedoms. We defend your right to speak freely, to control and protect your creative work, to be treated without discrimination, and to be free from harassment when people don't like what you have to say.
Facebook Followers 669
179. Northwest Business Law Blog RSS Feed
RSS Feed Follow RSS Blog nwbizlaw.com
Key topics covered are Business Law, Breach of Contract, Business Assets, Corporate Law Suits, Intellectual Property Litigation, and Partnership disputes. Northwest Business Law's mission is to assist entrepreneurs and small to mid-size companies in the navigation of their legal needs and business strategies.
Frequency 3 posts / year
180. Ethical Investigator RSS Feed
RSS Feed ethicalinvestigator.com/feed Follow RSS Blog ethicalinvestigator.com
The Ethical Investigator by Charles Griffin Intelligence covers asset search, due diligence, and other private corporate investigation matters. Charles Griffin Intelligence is a New York-based consulting firm that assists lawyers, corporations, and individuals with fact-finding for global litigation and due diligence.
Facebook Followers 8Twitter Followers 655 Frequency 1 post / quarter Since Mar 2011
181. The Legal Reports RSS Feed
RSS Feed thelegalreports.com/feed Follow RSS Blog thelegalreports.com
First and Leading legal news and media website in Uganda. At The legal reports, we make sure you are updated with all law and legal affairs in Uganda.
Facebook Followers 2.6KTwitter Followers 1.8K Frequency 30 posts / year
182. The Expert Institute RSS Feed
RSS Feed expertinstitute.com/resource.. Follow RSS Blog expertinstitute.com
Blog posts cover Legal News, Expert Insights, Legal Tech Solutions, Litigation Monitor, Trial Tactics, Cross-Examination, and Establishing Damages & Liability. Expert Institute is the leading expert witness services firm that connects attorneys with the exceptional expertise they need to win more cases.
Facebook Followers 1.6K Frequency 30 posts / year
183. SenftLegal RSS Feed
RSS Feed Follow RSS Blog senftlegal.com
Scott Senft and his team of law experts provide you with diverse possible solutions to your legal issues and explain them to you.
Twitter Followers 15
184. The Law Product Makers Blog RSS Feed
RSS Feed lawproductmakers.com/feed Follow RSS Blog lawproductmakers.com
Covers articles about the legal issues such as virtual lawyering, storing data in the cloud, ethical issues around the online delivery of legal services, and other topics. The Law Product Makers Blog is for lawyers and others who are interested in the subject of productizing legal services.
Facebook Followers 2Twitter Followers 4.4K Frequency 1 post / year
185. The Blog for Business Law RSS Feed
RSS Feed theblogforbusinesslaw.com/feed Follow RSS Blog theblogforbusinesslaw.com
The Blog for Business Law is a blog about business, the law, and fun. The lawyers regularly post articles and alerts on emerging business, legal, judicial and regulatory developments in areas such as intellectual property, human resources, construction and real estate, environmental compliance, and the many, many considerations that arise when buying and selling businesses.
Twitter Followers 232
186. Mack's Criminal Law Blog RSS Feed
RSS Feed mackscriminallaw.com/law-blo.. Follow RSS Blog mackscriminallaw.com
Mack's Criminal Law Blog provides insight, information and resources. It is dedicated to providing up-to-date and insightful information and blog posts on Canadian criminal law. It is an invaluable resource for criminal lawyers, judges and students.
Twitter Followers 747 Frequency 1 post / year
187. FDA Law Blog RSS Feed
RSS Feed fdalawblog.net/feed Follow RSS Blog thefdalawblog.com
A blog by Food and Drug Attorneys at Hyman, Phelps & McNamara, P.C. Blog posts cover FDA News, Orphan Drugs, Animal Drugs & Feeds, cGMP Compliance, Dietary Supplements, Health Privacy, Reimbursement, and Orphan Drugs.
Twitter Followers 4.7K Frequency 9 posts / quarter
188. ICL Media Review RSS Feed
RSS Feed iclmediareview.com/feed Follow RSS Blog iclmediareview.com
Created in January 2011, ICL Media Review is a daily survey of international criminal and international human rights news and developments which affect international law. It aims to provide its survey of news and events in a neutral and impartial manner.
Facebook Followers 481Twitter Followers 2.8K Since Jan 2011
189. Gore & Kuperman Blog RSS Feed
RSS Feed goreandkuperman.com/blog/feed Follow RSS Blog goreandkuperman.com
Follow this blog to find factful information about Criminal Laws, Personal Injury Laws, Civil Litigation and get top answers form Mark Gore & Boris Kuperman.
Facebook Followers 1.1KTwitter Followers 96 Frequency 21 posts / year Since May 2018
190. LAWPHILIC RSS Feed
RSS Feed lawphilic.law.blog/feed Follow RSS Blog lawphilic.com
Consistent & committed to providing legal awareness, opportunities and knowledge via our legal videos, write-ups, posts, and much more.
Facebook Followers 61Twitter Followers 5Instagram Followers 78 Frequency 1 post / quarter
191. Corporate Law and Governance RSS Feed
RSS Feed corporatelawandgovernance.bl.. Follow RSS Blog corporatelawandgovernance.blogspot.com
His site's primary focus is the UK but interesting items from other jurisdictions are often included as are developments in the allied disciplines of capital market regulation and financial reporting.
Twitter Followers 181 Since Jan 2008
192. Risk Settlements RSS Feed
RSS Feed risksettlements.com/feed Follow RSS Blog risksettlements.com
Risk Settlements is the leading provider of class action solutions for businesses that are already in litigation. Our experienced team uses proprietary quantitative and qualitative analyses to provide companies' legal teams with customized solutions to meet specific legal needs and financial objectives.
Twitter Followers 10 Since Jul 2015
193. Online Legal Translations RSS Feed
RSS Feed onlinelegaltranslations.com/.. Follow RSS Blog onlinelegaltranslations.com
Online Legal Translations provides Quality Legal Translations performed solely by Lawyer-Translators. We provide quality, professional translation services for Corporate Legal Departments, Law Firms, Government Entities, and Individuals.
Facebook Followers 1.3KTwitter Followers 233Instagram Followers 226 Since Oct 2017
194. Wheeler Law Firm, LLC RSS Feed
RSS Feed awheelerlaw.com/feed Follow RSS Blog awheelerlaw.com
Wheeler Law Firm is an experienced Family Law Firm serving Indianapolis and surrounding areas.
Facebook Followers 269
195. Sinka llc RSS Feed
RSS Feed sinkallc.com/feed Follow RSS Blog sinkallc.com
Sinka llc is a proactive boutique law firm, with a global perspective and attention to detail. We are based in Cyprus and represent closely-held businesses, families, and high net worth individuals.
Twitter Followers 3K
196. Cook Law, LLC RSS Feed
RSS Feed cooklawyerllc.com/feed Follow RSS Blog cooklawyerllc.com
Get more information by reading our blogs about credit reporting errors, personal injury, car accidents, and background checks.
Facebook Followers 108 Frequency 1 post / year
197. Elawvation RSS Feed
RSS Feed elawvation.com/feed Follow RSS Blog elawvation.com
Tools and news for lawyers, attorneys. Wellness and wellbeing news. Work-life balance secrets. Lawyer's life. Fashion for lawyers
Facebook Followers 253Instagram Followers 1.1K Frequency 1 post / year
198. Khashan Law RSS Feed
RSS Feed khashanlaw.com/feed Follow RSS Blog khashanlaw.com
The Khashan Law Firm is a full-service general practice law center representing clients throughout Southern California in a wide array of legal issues. Although the Khashan Law Firm primarily focuses on representing individuals injured in all types of accidents, our Attorneys have a wide variety of experience and knowledge and have represented thousands of clients in serious Personal Injury cases and more.
Facebook Followers 1.3KInstagram Followers 797 Frequency 23 posts / year Since Nov 2017
199. Law Daily RSS Feed
RSS Feed blogger.com/feeds/3239069528.. Follow RSS Blog thelawdaily.blogspot.com
The Law Daily publishes articles related to the field of law throughout the year and aims towards accomodating every qualitative submission to create an open-access platform for legal news.
Instagram Followers 121 Frequency 9 posts / year
200. AishMGhrana | Law Governance Responsibility RSS Feed
RSS Feed aishmghrana.me/feed Follow RSS Blog aishmghrana.me
Writer of this blog, Aishwarya Mohan Gahrana is Practicing Company Secretary and Insolvency Professional working with M/s Aishwarya M Gahrana & Associates, a New Delhi based peer reviewed firm of company secretaries having pan India presence through friends and associates.
Facebook Followers 6.5KTwitter Followers 925Instagram Followers 216 Frequency 4 posts / year Since Feb 2011
201. Bagneris Law Firm Blog RSS Feed
RSS Feed bagnerislawfirm.com/feed Follow RSS Blog bagnerislawfirm.com
Suzette Bagneris is the owner of the Bagneris Law Firm located in New Orleans, Louisiana. She brings unparalleled passion and compassion to each case. Personal Injury and Criminal Litigation Firm that has consistently obtained multi-million dollar settlements and verdicts for clients in Louisiana. The firm is an experienced civil litigation firm with decades of combined experience serving both plaintiffs and defendants in a wide range of different cases. These different legal cases include both personal injury cases and business disputes.
Facebook Followers 436Twitter Followers 40 Since Oct 2018
202. Louis Lehot Blog RSS Feed
RSS Feed louislehot.com/feed Follow RSS Blog louislehot.com
Keep up with the latest news and updates on the Louis Lehot blog. Louis Lehot helps businesses and ventures with compelling technologies reach their growth objective with sound legal strategies and solutions.
Facebook Followers 9.3KTwitter Followers 1.2K Frequency 1 post / year
203. The Cyprus Lawyer RSS Feed
RSS Feed thecypruslawyer.com/feed Follow RSS Blog thecypruslawyer.com
The life and practise of a lawyer in Cyprus. Harris Sharpe is a qualified lawyer practising in Cyprus with extensive experience in corporate and commercial law.
Facebook Followers 750Twitter Followers 441 Frequency 1 post / year
204. Ernest G. Ianetti, Esq. RSS Feed
RSS Feed ianetti.legal/answers?format.. Follow RSS Blog ianetti.legal
Over 30 Years of Professional Experience in Bankruptcy, Family Law, and Criminal Law. Personal, practical solutions to complex bankruptcy, family law & criminal defense legal matters.
Facebook Followers 4
205. M|L|B RSS Feed
RSS Feed malasevschi.wordpress.com/feed Follow RSS Blog malasevschi.wordpress.com
The M|L|B is an initiative which aims to approach important decisions of national and EU courts and law related issues.
Facebook Followers 246Twitter Followers 35Instagram Followers 659
206. Cultural Heritage Lawyer Rick St. Hilaire RSS Feed
RSS Feed culturalheritagelawyer.blogs.. Follow RSS Blog culturalheritagelawyer.blogspot.com
A lawyer's commentary on cultural property law and cultural heritage law; the illegal antiquities trade; looted, stolen, smuggled, and illicit artifacts; art theft; museum administration and risk management; and the laws and lawyers impacting cultural heritage, cultural property protection, antiquities dealers, auction houses, and archaeology.
Twitter Followers 3.2K Since Jan 2010
207. Iowa Employment Law Blog RSS Feed
RSS Feed iowaemploymentlawblog.com/feed Follow RSS Blog iowaemploymentlawblog.com
Iowa Employment Law Blog is written by Patrick Smith of Bradshaw Fowler Proctor & Fairgrave, PC's Employment & Labor practice group focusing on matters related to employment & labor litigation, disputes, benefits, unfair practice, and wage & hour claims in Iowa.
Twitter Followers 54
208. Gordon & Rees Construction Law Blog RSS Feed
RSS Feed grconstructionlawblog.com/feed Follow RSS Blog grconstructionlawblog.com
Gordon & Rees Construction Law Blog is a forum on Key Legal Issues for Design Professionals, Contractors and Developers.
Twitter Followers 1.2K Frequency 1 post / year
209. Power Legal Group Blog RSS Feed
RSS Feed powerlegalgroup.com/blog/feed Follow RSS Blog powerlegalgroup.com
LA Personal Injury Lawyer Bobby Yaghoubian started the Power Legal Group because he wanted to have a Los Angeles law firm that offered aggressive representation combined with personalized service. They are dedicated to serving all of the people of Southern California from all walks of life and pursuing maximum compensation in every case they take.
Facebook Followers 80Twitter Followers 19
210. Schiffrinpa | South FL Personal Injury Attorney RSS Feed
RSS Feed schiffrinpa.com/feed Follow RSS Blog schiffrinpa.com
Read the personal injury & accident law blog blog by the attorneys at Mark Schiffrin P. A. Find all the legal resources and help in Florida.
Facebook Followers 60
211. Shiner Law Group RSS Feed
RSS Feed masstortlawyer.org/feed Follow RSS Blog masstortlawyer.org
We are Top Attorneys Handling Mass Tort Litigation and Class Action Lawsuits.
Facebook Followers 3KInstagram Followers 2.2K
212. Export Law Blog RSS Feed
RSS Feed exportlawblog.com/feed Follow RSS Blog exportlawblog.com
On the Export Law Blog, Clif Burns provides latest news on DDTC, BIS, OFAC, and other export law matters. Mr. Burns is a Bryan Cave LLP attorney specializing in export control and economic sanctions.
Twitter Followers 533 Since Nov 2013
213. Real Legal News RSS Feed
RSS Feed reallegalnews.com/feed Follow RSS Blog reallegalnews.com
Real Legal News (RLN) is a collection of legal news and information from in house reporters and local attorneys. Our goal is to inform and educate the public about everything legal.
Since Oct 2019
214. softrights RSS Feed
RSS Feed thaworldtakes.com/feed Follow RSS Blog thaworldtakes.com
This blog aims to entertain and inform, in that order. Want legal advice? Look elsewhere. Better yet, call me!
Frequency 1 post / year Since Apr 2012
215. Welcome to the law basic RSS Feed
RSS Feed laymanlawbasics.blogspot.com.. Follow RSS Blog laymanlawbasics.blogspot.com
A blog about basic facts, environment related topics, general topics and law related information.
216. Pecori and Pecori Attorneys at Law RSS Feed
RSS Feed pecorielderlaw.blogspot.com/.. Follow RSS Blog pecorielderlaw.blogspot.com
Pecori & Pecori is a third generation law firm founded in 1940. We offer the high-quality personal service that only a small firm can provide. Whether you need a Pittsburgh Estate Planning Lawyer, a Pittsburgh Probate Lawyer or a Pittsburgh Elder Law Lawyer, we can help you.
Since Feb 2020
217. Estrin Legal Staffing RSS Feed
RSS Feed estrinlegalstaffing.com/feed Follow RSS Blog estrinlegalstaffing.com
Over 25 years of staffing experience in AmLaw200 law firms and in-house legal departments. We practice ethical recruiting and offer clients and candidates top-tier service. You'll get the benefit of our proven track record as we work hard for you whether we are recruiting for you or helping you find that dream job.
Facebook Followers 23 Frequency 1 post / quarter
218. Joshua Rogala | Winnipeg Criminal Defence Lawyer RSS Feed
RSS Feed winnipegcriminaldefencelawye.. Follow RSS Blog winnipegcriminaldefencelawyer.ca
Joshua Rogala's legal blog provides information about the law, Winnipeg news stories, and tid-bits of information that are both interesting and educational.
Twitter Followers 42 Frequency 25 posts / year
219. Flock of Legals RSS Feed
RSS Feed flockoflegals.com/feed Follow RSS Blog flockoflegals.com
Covers articles on California Criminal Law, DUI Law, Personal Injury Law, Traffic Tickets, and more. Flock of Legals is created by California lawyers with the primary goal of creating a free legal database of legal information accessible to all.
Facebook Followers 135Twitter Followers 18 Since Mar 2018
220. The Rainmaker Blog | Law Firm Marketing & Business Development RSS Feed
RSS Feed therainmakerblog.com/feed Follow RSS Blog therainmakerblog.com
The Rainmaker Blog provides law firm marketing and business development strategies. It is published by The Rainmaker Institute. Stephen Fairley is the CEO of The Rainmaker Institute.
Twitter Followers 26.7K
221. Hoban Law Group RSS Feed
RSS Feed hoban.law/feed Follow RSS Blog hoban.law
Stay up to date with Cannabis Industry Insights. Hoban Law Group is an industrial hemp & cannabis industry law firm, recognized in the canna-business, industrial hemp farming, and hemp production community
Facebook Followers 3KTwitter Followers 2.3K
222. HarryClarkLaw Blog RSS Feed
RSS Feed hclark.law.blog/feed Follow RSS Blog harryclarklaw.com
Articles are geared towards aspiring solicitors, covering a variety of legal topics from Training Contract applications, to commercial awareness, to my own personal insights into the world of law. Harry Clark is a Trainee Solicitor, law blogger, and tech enthusiast.
Twitter Followers 491Instagram Followers 4.1K
223. Legal Edge Services RSS Feed
RSS Feed legaledgeservices.com/feed Follow RSS Blog legaledgeservices.com
This blog for attorneys by Legal Edge Services features tips to help you to be more productive and proven ways to increase billable hours. Legal Edge Services is the premier provider of turn-key law office solutions for the legal community.
Facebook Followers 832 Frequency 3 posts / quarter
224. Seda Law Firm RSS Feed
RSS Feed Follow RSS Blog sedalawfirm.com
Covers articles related to estate planning, probates, and real property matters. Seda Law Firm PLLC is based in Oklahoma City serving clients in Oklahoma, Texas, New Mexico and North Dakota.
Facebook Followers 601
225. Legal Support World RSS Feed
RSS Feed legalsupportworld.blogspot.c.. Follow RSS Blog legalsupportworld.blogspot.com
Since 2008, Legal Support World has been offering legal outsourcing services and legal support solutions through innovative thought leaders who put forth their knowledge and experience to fulfill the individual expectations of each client. We are a leading, pure-play outsourcing company that helps clients augment their internal capabilities and retain superior quality and proficiency with utmost cost effectiveness.
Facebook Followers 743Twitter Followers 1.3K Frequency 2 posts / year Since Nov 2014
226. KS Legal and Associates RSS Feed
RSS Feed kslegal.co.in/feed Follow RSS Blog kslegal.co.in
KS Legal and Associates blog contains posts on various legal-related information, such as family, divorce, property, insurance, banking, commercial, etc. As a boutique law firm, KS Legal provides top-quality advice on corporate and commercial law for everyone from blue-chip companies to start-ups and is a go-to for international firms and clients.
227. Bloomsbury Law Online Blog RSS Feed
RSS Feed law.bloomsburyprofessional.c.. Follow RSS Blog law.bloomsburyprofessional.com
A comprehensive source of information to the UK tax & accountancy markets. Features articles on Family Law, Intellectual Property & Media Law, Employment Law, and Company & Commercial Law. Bloomsbury Tax is part of Bloomsbury Professional, the UK's leading independent law & tax publisher.
Facebook Followers 340Twitter Followers 3.5KInstagram Followers 53 Since Mar 2011
228. Knowledge Of The Law RSS Feed
RSS Feed knowledgeofthelaw.com/feed Follow RSS Blog knowledgeofthelaw.com
Knowledge Of The Law is a legal blog. We share tips on how to become a lawyer, law students' tips, law school guides and tips, definitions of various law courses, how to find a lawyer, hiring a good lawyer, paralegal tips, and lawyers' salaries.
Facebook Followers 52 Frequency 4 posts / quarter
229. The Contracts Guy RSS Feed
RSS Feed feeds.feedburner.com/thecont.. Follow RSS Blog thecontractsguy.net
Hi, I'm Brian Rogers, a business law attorney licensed in Missouri and Illinois and practicing in St. Louis. I'm the founder of Blue Maven Law, LLC, a business law firm that focuses on helping buyers and sellers of small businesses navigate the legal aspects of their transactions, company formation, contracts, and general business law advice.
230. Construction Law Signal RSS Feed
RSS Feed constructionlawsignal.com/feed Follow RSS Blog cohenseglias.com
Construction Law Signal is written by the Construction Lawyers at Cohen Seglias Law Firm and offers legal updates and insights on Construction matters. The blog is designed to provide regular news on construction related issues in the Mid-Atlantic region, with practical commentary and analysis from the Cohen Seglias Construction Group.
Facebook Followers 185Twitter Followers 536
231. Bloomberg Law Podcast RSS Feed
RSS Feed feeds.bloomberg.fm/BLM529674.. Follow RSS Blog bloomberg.com
Bloomberg Law Podcast examines all aspects of the legal profession, from intellectual property law to criminal law, from bankruptcy to securities law, drawing on the deep research tools of BloombergLaw. In each episode, Host June Grasso speaks with prominent attorneys to analyze major legal issues & cases in the news.
Facebook Followers 4.2MTwitter Followers 7.8MInstagram Followers 5.3M Since Nov 2016
232. Zegal RSS Feed
RSS Feed Follow RSS Blog zegal.com
Covers articles on small business legal and commercial issues, latest legal and business tips, tools and resources. Zegal is the end-to-end platform for the legals smaller companies need.
Facebook Followers 3.1KTwitter Followers 1.7K
233. Lawrina RSS Feed
RSS Feed Follow RSS Blog lawrina.com/blog
Covers news, comprehensive insights, and legal advice. Lawrina helps to understand American law by making legal information available in a simple, systematic, and accessible way.
Facebook Followers 119Twitter Followers 63
234. Scarinci Hollenbeck » Law Firm Insights RSS Feed
RSS Feed Follow RSS Blog scarincihollenbeck.com
Articles feature the latest firm insights and topics including Business Law, Entertainment and sports, Labor and employment, IP, Cybersecurity, Environmental law, Cannabis, Tax, and more. Scarinci Hollenbeck is a full-service, general practice business law firm that provides a broad range of legal services to a diverse group of clients.
Facebook Followers 1.9KTwitter Followers 7.5K
235. Sheria Na Jamii RSS Feed
RSS Feed sherianajamii.blogspot.com/f.. Follow RSS Blog sherianajamii.com
A blog about legal articles, cases, legal documents, substantive laws, procedural laws, and other legal affairs worldwide. Sheria Na Jamii is a free online platform for varieties of legal content on selected topics of several legal affairs worldwide.
Twitter Followers 826
236. Attorney-At-Law Journal RSS Feed
RSS Feed attyatlawjournal.blogspot.co.. Follow RSS Blog attyatlawjournal.blogspot.com
Attorney-At-Law Journal is a pesonal blogsite sharing the pursuits in life, law and love
Since Aug 2012
237. JETLaw | Vanderbilt Journal Of Entertainment & Technology Law RSS Feed
RSS Feed jetlaw.org/feed Follow RSS Blog vanderbilt.edu
JETLaw is committed to reaching a wide audience by providing a forum for dialogue between scholars, students, and practitioners on all legal matters pertaining to the fields of entertainment and technology. The Vanderbilt Journal of Entertainment and Technology Law is an official, highly ranked, student-run publication of Vanderbilt University Law School and publishes four issues annually.
Facebook Followers 333Twitter Followers 321
238. Sports and Entertainment Law Insider RSS Feed
RSS Feed sportslawinsider.com/feed Follow RSS Blog sportslawinsider.com
Sports and Entertainment Law Insider is your all-access pass to the latest legal developments impacting the business of sports and entertainment.
Since Jun 2012
239. Expert Witness Blog RSS Feed
RSS Feed advancedassessments.co.uk/Bl.. Follow RSS Blog advancedassessments.co.uk
Follow us to keep up with our articles About Psychological Assessment & Expert Witness Assessment Will Teach Everything You Need to Know.
Facebook Followers 170Twitter Followers 92
240. Race and the Law Prof Blog RSS Feed
RSS Feed lawprofessors.typepad.com/ra.. Follow RSS Blog lawprofessors.typepad.com
Law Professor Blogs, LLC is the nation's only network of legal blogs edited primarily by law professors. Law Professor Blogs, LLC's legal blogs are edited by over 100 law professors, deans, and lawyers. Editors include leading scholars and educators who are committed to providing the web source of legal news, information, commentary, and analysis for law professors, practitioners, government and nonprofit lawyers, and students in their respective fields. Most of the network's blogs are owned by Law Professor Blogs, LLC. Several blogs are affiliates of the network.
241. Overlawyered RSS Feed
RSS Feed overlawyered.com/feed Follow RSS Blog overlawyered.com
Overlawyered, published by the Cato Institute in 2013, began in July 1999 and is regularly described as the oldest law blog; at least, no one seems to be able to name one that's older. Its founder and predominant writer are Walter Olson, a senior fellow at Cato and author of several books about the U.S. legal system including The Litigation Explosion, The Excuse Factory, The Rule of Lawyers, and Schools for Misrule.