Top 100 Law RSS Feeds

Follow Top 100 Law RSS Feeds from one place on FeedSpot Reader
The best Law rss feed list curated from thousands of rss feeds on the web and ranked by relevancy, authority, social media followers & freshness.

Law RSS Feeds

Here are 100 Best Law RSS Feeds you should follow in 2024

1. SCOTUS Blog RSS Feed

SCOTUS Blog RSS Feed scotusblog.com/feed   Follow RSS Blog scotusblog.com
Devoted to covering the US Supreme Court and its cases. Written by lawyers, students, and journalists, SCOTUS Blog is widely regarded as one of the nation's premier legal Internet sites.
Facebook Followers 37.5KTwitter Followers 601.2K Frequency 1 post/day Export RSS feeds list Get access to 250k active RSS feeds of news websites, blogs, magazines and podcasts with email contacts in 1500 niche categories. Get targeted RSS list in your niche at your fingertips. Email us the categories of RSS feeds you're interested in at anuj@feedspot.com Copy email. We'll share the list in an Excel spreadsheet or CSV format.

2. ABA Journal RSS Feed

ABA Journal RSS Feed feeds.feedburner.com/abajour..   Follow RSS Blog abajournal.com
The ABA Journal, the flagship publication of the American Bar Association, delivers comprehensive coverage of legal news, analysis, and features. Edited by John O'Brien, the journal provides updates on significant legal developments and insights from numerous expert legal bloggers. The editorial team includes Kevin Davis as Managing Editor, with Victor Li and Lee Rawles serving as Assistant Managing Editors. The magazine is widely read within the legal community and also contributes to educational initiatives and legal system improvements.
Facebook Followers 26.1KTwitter Followers 106.1KInstagram Followers 7.4K Frequency 30 posts/month

3. Above the Law RSS Feed

Above the Law RSS Feed abovethelaw.com/feed   Follow RSS Blog abovethelaw.com
Above the Law is a prominent legal blog that offers a behind-the-scenes look at the world of law, focusing on breaking news, insights, and commentary on legal developments and the profession's most influential personalities and institutions. Founded and published by Breaking Media, the blog features contributions from a diverse editorial team, including Staci Zaretsky, Joe Patrice, and Kathryn Rubino. Above the Law is known for its candid and often irreverent coverage of the legal industry, providing a platform for legal professionals to stay informed and engaged.
Facebook Followers 75.1KTwitter Followers 182.5K Frequency 13 posts/day

4. Lawyerist News RSS Feed

Lawyerist News RSS Feed feeds.feedburner.com/solosma..   Follow RSS Blog lawyerist.com
Lawyerist is home to the largest online community of solo and small-firm lawyers in the world.Their goal is to help lawyers build better law practices by bringing together a group of innovative lawyers to share ideas, experiments, and best practices.
Facebook Followers 21.7KTwitter Followers 57.9KInstagram Followers 2K Frequency 2 posts/week Since Jan 2007

5. Law » New Jersey Law Journal RSS Feed

Law » New Jersey Law Journal RSS Feed feeds.feedblitz.com/law/lega..   Follow RSS Blog law.com
The New Jersey Law Journal, a prominent publication under the Law.com network, offers comprehensive coverage on legal news, developments, and insights specific to New Jersey. It aims to provide legal professionals with the critical intelligence needed to succeed in their practices. Law.com, the parent platform, supports 18 award-winning publications, delivering news, analysis, and strategy to empower legal professionals. The editorial team includes notable contributors such as David Gialanella, Business of Law, and Max Mitchell, Regional Coverage, ensuring high-quality, in-depth reporting across various legal topics.
Facebook Followers 8.9KTwitter Followers 59.6K Frequency 14 posts/day

6. Reason » The Volokh Conspiracy RSS Feed

Reason » The Volokh Conspiracy RSS Feed reason.com/category/volokh/f..   Follow RSS Blog reason.com
The Volokh Conspiracy is a legal blog hosted by Reason, offering insightful analysis on a broad spectrum of legal and constitutional issues. Founded by Eugene Volokh, a distinguished professor of law at UCLA, the blog features contributions from a team of esteemed legal scholars and practitioners. Known for its rigorous and accessible commentary, The Volokh Conspiracy delves into complex legal debates and current judicial decisions, making it a valuable resource for both legal professionals and those interested in the law.
Facebook Followers 4.2KTwitter Followers 24.2KInstagram Followers 588 Frequency 10 posts/day

7. LawSites RSS Feed

LawSites RSS Feed lawnext.com/feed   Follow RSS Blog lawnext.com
LawNext is a blog dedicated to exploring legal technology and innovation, created by Robert Ambrogi, a seasoned lawyer and journalist. Robert has been writing about legal tech, practice, and ethics for over two decades, hosting the LawNext podcast, which features interviews with key innovators in the legal field. He also writes for Above the Law and has received numerous awards, including the Yankee Quill Award for journalism and recognition as a Legal Rebels Trailblazer by the ABA Journal.
Twitter Followers 28.7K Frequency 2 posts/day

8. Harris Bricken Sliwoski Canna Law Blog RSS Feed

Harris Bricken Sliwoski Canna Law Blog RSS Feed harrisbricken.com/cannalawbl..   Follow RSS Blog harrisbricken.com
The Canna Law Blog is a forum for discussing the practical aspects of cannabis law and how it impacts those involved in this growing industry. It will provide insight into how canna businesspeople can use the law to their advantage.
Facebook Followers 163.5KTwitter Followers 5.3K Frequency 2 posts/week

9. The Lawyers Corner RSS Feed

The Lawyers Corner RSS Feed lawyerscorner.net/feed   Follow RSS Blog lawyerscorner.net
Lawyers Corner is a comprehensive blog that aggregates legal information and commentary from various local attorneys, addressing current legal issues and providing practical advice across multiple areas of law. The blog covers a wide range of topics, including family law, personal injury, criminal defense, business law, and immigration law. It is designed to be a resource for both legal professionals and the general public, offering insights and updates on pertinent legal matters.
Facebook Followers 870Twitter Followers 299 Frequency 1 post/month

10. fourthamendment.com RSS Feed

fourthamendment.com RSS Feed   Follow RSS Blog fourthamendment.com
FourthAmendment.com is a specialized blog dedicated to the latest developments and legal interpretations of the Fourth Amendment, focusing on search and seizure law. The blog is authored by John Wesley Hall, a prominent criminal defense lawyer and recognized expert in Fourth Amendment issues. Hall's extensive legal experience provides readers with in-depth analyses of recent court decisions, legislative changes, and practical implications for law enforcement and legal practitioners. The blog serves as a valuable resource for those interested in constitutional law and criminal justice.
Frequency 10 posts/week

11. LLB Guide RSS Feed

LLB Guide RSS Feed llbguide.com/feed   Follow RSS Blog llbguide.com
LLBguide.com is a Professional Educational Platform providing a comprehensive guide to all LLB Subjects. Here you will find easy and helpful law-related content even if you are a student or a practicing lawyer. The site creators are focused and dedicated to making laws easy to understand for everyone by providing notes with a focus on dependability.
Frequency 1 post/quarter

12. Jurists Global Blog RSS Feed

Jurists Global Blog RSS Feed juristsglobal.com/f.atom   Follow RSS Blog juristsglobal.com
JURISTS GLOBAL'S vision is to make 'Legal access' democratic by making it neutral affordable and without boundaries. We are creating the world's first and the best 'Preventive Legal Care Ecosystem' for all and our mission is zero litigation and faster Solutions to all existing litigations in India and global justice seekers to meet their optimum need for support their interest of Global Presence.
Facebook Followers 55Twitter Followers 52 Frequency 2 posts/month

13. The IP Law Blog RSS Feed

The IP Law Blog RSS Feed feeds.lexblog.com/TheIpLawBlog   Follow RSS Blog theiplawblog.com
The IP Law Blog, managed by Weintraub Tobin, offers expert commentary on various intellectual property issues, including copyrights, trademarks, patents, trade secrets, false advertising, and licensing. Authored by seasoned IP attorneys, the blog aims to help businesses and individuals protect their intangible assets. Key contributors include Audrey Millemann, Eric Caligiuri, Jessica Corpuz, James Kachmar, Jo Dale Carothers, and Scott Hervey, who bring extensive experience and knowledge to their analyses.
Facebook Followers 315Twitter Followers 15 Frequency 4 posts/month

14. Verdict RSS Feed

Verdict RSS Feed verdict.justia.com/feed   Follow RSS Blog verdict.justia.com
Verdict is a legal analysis blog hosted by Justia, providing expert commentary on significant legal issues and developments. Justia, headquartered in Mountain View, California, is dedicated to making law and legal resources freely accessible to everyone. Founded by Tim Stanley, a pioneer in online legal information, the blog features contributions from a distinguished editorial team including professors, attorneys, and legal scholars. Justia's mission extends beyond the blog, offering a wide range of free legal resources and marketing solutions for law firms.
Facebook Followers 3.3KTwitter Followers 8.2K Frequency 4 posts/week

15. FindLaw Legal Blogs RSS Feed

FindLaw Legal Blogs RSS Feed feeds.findlaw.com/LawAndLife   Follow RSS Blog findlaw.com
Get the latest legal news and information, and learn more about laws that impact your everyday life with FindLaw Legal Blogs. Here, Both consumers & legal professionals can find answers, insights, and updates on legal issues.
Facebook Followers 46.3KTwitter Followers 17.9KInstagram Followers 1.5K Frequency 29 posts/year

16. Clio Blog RSS Feed

Clio Blog RSS Feed clio.com/blog/feed   Follow RSS Blog clio.com/blog
Clio was launched in 2008 by lifelong friends Jack Newton and Rian Gauvreau with the goal of transforming the practice of law for good by delivering cloud-based practice management technologies for lawyers around the world.
Facebook Followers 20KTwitter Followers 16.7KInstagram Followers 7.7K Frequency 1 post/week Since Jan 2013

17. North Carolina Criminal Law RSS Feed

North Carolina Criminal Law RSS Feed nccriminallaw.sog.unc.edu/?f..   Follow RSS Blog nccriminallaw.sog.unc.edu
The North Carolina Criminal Law blog, hosted by the UNC School of Government, provides insightful analysis and updates on criminal law and procedure specific to North Carolina. Launched in 2009, it serves as a valuable resource for legal professionals and the public. The blog features contributions from a team of knowledgeable faculty members, including Jeffrey Welty, who has authored over 1,100 posts. Topics range from case summaries and evidence to motor vehicles and sentencing, ensuring comprehensive coverage of relevant legal issues.
Twitter Followers 6K Frequency 1 post/day

18. Mondaq RSS Feed

Mondaq RSS Feed mondaq.com/Company/Rss?monda..   Follow RSS Blog mondaq.com
Mondaq is a premier content aggregator service that has been providing invaluable legal, regulatory, and financial insights since its establishment in 1994. Headquartered in New York and Bristol, the platform curates high-quality content from leading professional services firms worldwide, making it a vital resource for legal professionals, businesses, and consumers. Under the guidance of key figures like Chief Product Officer Richard Anderson, Mondaq delivers approximately 5,000 articles per month on diverse topics, including employment, tax, litigation, healthcare, and real estate. The platform not only disseminates critical information but also offers advanced analytics to help firms understand and optimize their content strategy, making it an indispensable tool in the legal industry.
Facebook Followers 115Twitter Followers 4.6K Frequency 30 posts/year

19. JD Supra RSS Feed

JD Supra RSS Feed   Follow RSS Blog jdsupra.com
JD Supra is a prominent platform founded by Aviva Cuyler in 2008, providing legal news, analysis, and commentary from a vast network of attorneys and professionals. Headquartered in San Francisco, JD Supra leverages thought leadership to offer new business opportunities, media attention, and networking for legal professionals. The platform features contributions from over 50,000 authors from leading law firms, making it a critical resource for up-to-date legal insights. JD Supra is known for its high factual reporting and minimal bias, ensuring reliable and balanced content for its readership?
Twitter Followers 21.8K Frequency 5 posts/month

20. Law360 RSS Feed

Law360 RSS Feed   Follow RSS Blog law360.com
Law360 is a premier legal news service providing real-time updates and in-depth analysis on a broad spectrum of practice areas and industries. With over 350 newsroom staff and more than 200 articles published daily, it covers crucial legal developments to help professionals stay informed and make swift, strategic decisions. Law360 also features expert analysis, breaking news alerts, and custom newsletters to cater to specific interests. Its reputation for reliable, non-partisan reporting is reinforced by accolades from the American Bar Association's Legal Technology Survey Report.
Facebook Followers 6.1KTwitter Followers 54.4K Frequency 10 posts/week

21. Jonathan Turley Blog RSS Feed

Jonathan Turley Blog RSS Feed jonathanturley.org/feed   Follow RSS Blog jonathanturley.org
Prof. Jonathan Turley is a nationally recognized legal scholar who has written extensively in areas ranging from constitutional law to legal theory & tort law. He writes about Constitutional Law, Environment, Free Speech, Lawyering, Politics, Religion, Supreme Court, and more.
Twitter Followers 612.4K Frequency 2 posts/day Since Aug 2007

22. How Appealing RSS Feed

How Appealing RSS Feed howappealing.abovethelaw.com..   Follow RSS Blog howappealing.abovethelaw.com
How Appealing is a widely respected blog that focuses on appellate litigation, managed by Howard J. Bashman, an accomplished appellate attorney based in Willow Grove, Pennsylvania. The blog offers frequent updates on important court decisions and legal news, particularly those involving the U.S. Supreme Court and federal appellate courts. Bashman, who has extensive experience arguing before the U.S. Court of Appeals for the Third Circuit and Pennsylvania's state appellate courts, also writes a monthly column for the Legal Intelligencer and a weekly column for Law.com. Known for its timely and comprehensive coverage, How Appealing is a key resource for legal professionals and scholars interested in appellate law.
Frequency 7 posts/day

23. The Law Society Blog RSS Feed

The Law Society Blog RSS Feed   Follow RSS Blog lawsociety.org.uk
The Law Society is the voice of solicitors, driving excellence in the profession and safeguarding the rule of law. The Law Society blog showcases work from around the organization & views from across the legal sector. Key topics covered are Public Law, Banking & Finance, Civil Litigation, Criminal Justice, Cybersecurity, GDPR, Immigration, and Social Welfare.
Facebook Followers 21KTwitter Followers 127.3KInstagram Followers 18.8K Frequency 1 post/week

24. Lawctopus RSS Feed

Lawctopus RSS Feed lawctopus.com/feed   Follow RSS Blog lawctopus.com
Lawctopus is a leading online platform established in 2010, dedicated to supporting law students in India by providing comprehensive resources, including internships, jobs, courses, and career advice. Founded by Tanuj Kalia,the site expanded its reach to the UK, USA, Europe, and Australia in 2018, offering global opportunities for law students and young professionals to enhance their careers through various events and resources?
Facebook Followers 53.3KTwitter Followers 31.3KInstagram Followers 45.6K Frequency 7 posts/day Since Sep 2010

25. Patently-O RSS Feed

Patently-O RSS Feed patentlyo.com/feed   Follow RSS Blog patentlyo.com
Patently-O is a leading patent law blog founded by Dennis Crouch, a law professor and former patent attorney. Established in 2004, it has become an essential resource for professionals involved in patent law, providing timely updates, detailed analyses, and insightful commentary on patent legislation, court decisions, and policy developments. The blog frequently features contributions from guest authors, including prominent legal scholars and practitioners, ensuring a diverse range of expert perspectives. Patently-O stands out for its commitment to maintaining high-quality, accessible information that caters to both legal professionals and academics interested in the nuances of patent law.
Twitter Followers 17.9K Frequency 1 post/day

26. Jurist News RSS Feed

Jurist News RSS Feed jurist.org/news/feed   Follow RSS Blog jurist.org
JURIST is a non-profit legal news service operated by law students, offering insightful coverage on the rule of law during crises. Founded by Bernard Hibbitts, a professor at the University of Pittsburgh School of Law, the platform provides well-documented legal news and analysis. Contributors include students from various law schools worldwide, under Hibbitts' editorial leadership, making JURIST a unique blend of educational initiative and professional news service. The blog's commitment to accuracy and comprehensiveness makes it a valuable resource for legal professionals and scholars.
Facebook Followers 17.4KTwitter Followers 13.9KInstagram Followers 1.8K Frequency 10 posts/day

27. Attorney at Work RSS Feed

Attorney at Work RSS Feed attorneyatwork.com/feed   Follow RSS Blog attorneyatwork.com
Attorney at Work is a comprehensive resource for legal professionals, delivering daily tips and insights to help lawyers enhance their practice and career. Founded in 2011, the blog features contributions from hundreds of industry experts and thought leaders. The editorial team includes Joan Feldman, Editor-in-Chief, with over 30 years of experience in legal publications, and Mark Feldman, Publisher, an award-winning art director. Attorney at Work covers various topics such as marketing, technology, and law firm management, offering free guides, product reviews, and a popular daily newsletter.
Facebook Followers 2.3K Frequency 2 posts/week

28. Law & Liberty RSS Feed

Law & Liberty RSS Feed lawliberty.org/feed   Follow RSS Blog lawliberty.org
Law & Liberty is a distinguished online platform dedicated to exploring the classical liberal tradition of law and political thought, emphasizing a society of free and responsible individuals. Sponsored by Liberty Fund, Inc., the site features rigorous debate, commentary, essays, book reviews, and interviews. Law & Liberty aims to examine foundational legal principles and contemporary issues. Notable contributors include various scholars and legal experts, providing diverse perspectives on maintaining a free society.
Facebook Followers 46.6KTwitter Followers 9.7K Frequency 2 posts/day

29. Lawyer Monthly RSS Feed

Lawyer Monthly RSS Feed lawyer-monthly.com/feed   Follow RSS Blog lawyer-monthly.com
Lawyer Monthly is a comprehensive news website and monthly publication dedicated to providing the latest significant legal news from around the globe. Covering key practice areas, jurisdictions, and sectors, the magazine offers insightful commentary on the current legal landscape. Utilizing a multi-platform approach, it delivers content through print and digital formats, including real-time online updates and social media. Lawyer Monthly aims to keep legal professionals informed and engaged with up-to-date news and expert analysis.
Facebook Followers 32KTwitter Followers 7.7KInstagram Followers 3K Frequency 7 posts/day

30. LexBlog RSS Feed

LexBlog RSS Feed lexblog.com/feed   Follow RSS Blog lexblog.com
LexBlog is a pioneering platform founded by Kevin O'Keefe in 2004, dedicated to empowering legal professionals through blogging and digital publishing. Originating from Kevin's vision to help lawyers build their online presence, LexBlog now supports over 25,000 bloggers, including those from the top law firms in the U.S. The editorial team includes professionals like Brian Biddle, Creative Director, and Colin O'Keefe, Publisher. LexBlog not only provides technology solutions but also fosters a global community for legal insights and networking.
Facebook Followers 988Twitter Followers 17.6K Frequency 30 posts/day

31. Legal Reader RSS Feed

Legal Reader RSS Feed legalreader.com/feed   Follow RSS Blog legalreader.com
Legal Reader is a dedicated legal blog established in 2002, focused on protecting consumers and exposing corporate and organizational misconduct. Founded and edited by Jay W. Belle Isle, the site features content from staff writers Dawn Allen, Briana Smith, Sara E. Teller, and Ryan J. Farrick, as well as guest posts from experts in consumer safety. Legal Reader prides itself on clear, accessible commentary, free from corporate advertising influence, ensuring unbiased information aimed at highlighting issues where profit is prioritized over safety.
Facebook Followers 764Twitter Followers 633 Frequency 3 posts/day

32. Legal Desire RSS Feed

Legal Desire RSS Feed legaldesire.com/feed   Follow RSS Blog legaldesire.com
Legal Desire is a leading legal news and information platform that has been at the forefront of the legal media industry for over a decade. Founded by Abhyuday Agarwal, the blog aims to provide credible advice and comprehensive insights on various legal topics to a global audience. Covering a wide range of subjects, from business law and intellectual property to human rights and criminal law, Legal Desire is known for its in-depth analysis and objective reporting. The editorial team comprises experienced journalists and legal experts who strive to keep readers informed about the latest developments in the legal world. Legal Desire also offers additional resources such as expert opinions, interviews, and a variety of legal courses and podcasts, ensuring that both legal professionals and the general public have access to valuable information and tools to stay updated in the fast-paced legal landscape.
Facebook Followers 88.6KTwitter Followers 917Instagram Followers 2K Frequency 3 posts/day

33. LawFuel RSS Feed

LawFuel RSS Feed lawfuel.com/feed   Follow RSS Blog lawfuel.com
LawFuel is a leading legal news blog that provides timely updates and in-depth analyses on various legal topics, catering to a global audience of legal professionals, students, and enthusiasts. Founded by John Bowie, LawFuel is renowned for its comprehensive coverage of the legal industry's latest developments, from high-profile cases to emerging trends in legal technology. The editorial team, including experienced legal journalists and contributors, ensures the content remains authoritative and engaging. LawFuel's commitment to delivering insightful commentary and up-to-date news makes it an essential resource for anyone interested in the legal field.
Facebook Followers 970Twitter Followers 2.3K Frequency 4 posts/day

34. Attorney at Law Magazine RSS Feed

Attorney at Law Magazine More images RSS Feed attorneyatlawmagazine.com/feed   Follow RSS Blog attorneyatlawmagazine.com
Since 2007, Attorney at Law Magazine has been published in local markets nationwide. Today, its online presence has expanded it to be a publication for lawyers and legal professionals as well as a resource for legal consumers. Beyond sharing informative articles and trending op-eds, Attorney at Law Magazine also spotlights the standout lawyers in the industry. With over 10 million magazines printed, Attorney at Law Magazine has the power of a print and digital publication.
Facebook Followers 3.9KTwitter Followers 1.3KInstagram Followers 2.7KLinkedIn Frequency 18 posts/week Get Contact

35. Asia Law Portal RSS Feed

Asia Law Portal RSS Feed asialawportal.com/feed   Follow RSS Blog asialawportal.com
Asia Law Portal is a leading blog that provides news, information, and insights on the legal markets across the Asia-Pacific region. Founded in 2013 following the Inter-Pacific Bar Association annual meeting in Seoul, the blog is modeled after the World Economic Forum's platforms. It features contributions from lawyers, legal professionals, and law students, covering topics such as legal innovation, key legal issues, and practice management.
Facebook Followers 3KTwitter Followers 19.6K Frequency 5 posts/month Since Jul 2020

36. Alqada Law Firm Blog RSS Feed

Alqada Law Firm Blog RSS Feed   Follow RSS Blog alqada.ae
blog post, articles related to law and regulations in Dubai, based on latest updates across UAE. Alqada is a Dubai-based legal claim collection agency that provides claims collection services to individuals and corporates.
Facebook Followers 154Instagram Followers 1K Frequency 10 posts/week

37. Harris Sliwoski China Law Blog RSS Feed

Harris Sliwoski China Law Blog RSS Feed chinalawblog.com/feed   Follow RSS Blog harris-sliwoski.com
A blog all about the business of China law & the law of China business. You'll get to learn how Chinese laws impact businesses in China. Harris Bricken is a boutique international law firm, offers specialized legal assistance to businesses that operate internationally.
Facebook Followers 24KTwitter Followers 907 Frequency 1 post/week Since Jan 2006

38. Technology & Marketing Law Blog RSS Feed

Technology & Marketing Law Blog RSS Feed blog.ericgoldman.org/feed   Follow RSS Blog blog.ericgoldman.org
The Technology & Marketing Law Blog, authored by Eric Goldman, is a comprehensive resource focusing on Internet law, intellectual property, and advertising law. Goldman, a professor at Santa Clara University School of Law and co-director of its High Tech Law Institute, has been blogging since 2005. His blog is recognized for its thorough analysis and updates on legal issues, including Section 230 of the Communications Decency Act. Goldman's work is highly regarded, frequently cited in court opinions, and he has been named an 'IP Vanguard' by the California State Bar.
Twitter Followers 15.1K Frequency 3 posts/week Since Feb 2005

39. Artificial Lawyer RSS Feed

Artificial Lawyer RSS Feed artificiallawyer.com/feed   Follow RSS Blog artificiallawyer.com
The Artificial Lawyer Blog is a forward-thinking platform that delves into the intersection of law and technology, with a particular focus on how artificial intelligence is revolutionizing the legal industry. The blog explores topics such as legal tech innovations, AI-driven contract analysis, and the future of legal practice in a digital world. It offers insightful commentary, interviews with industry leaders, and analysis of the latest trends in legal tech. This blog is an essential resource for legal professionals, technologists, and anyone interested in the profound changes AI is bringing to the legal landscape.
Twitter Followers 13K Frequency 2 posts/day

40. LexForti Legal RSS Feed

LexForti Legal RSS Feed lexforti.com/legal-news/feed   Follow RSS Blog lexforti.com
Offers access to a wide array of legal knowledge through the Daily Legal News segment of our Website. LexForti Legal News & Journal contains a vast assortment of resources that helps in understanding contemporary legal issues.
Facebook Followers 2.4KInstagram Followers 8.6K Frequency 1 post/month

41. Law In Sport RSS Feed

Law In Sport RSS Feed lawinsport.com/feed/rss/arti..   Follow RSS Blog lawinsport.com
LawInSport is a premier platform dedicated to sports law, providing expert analysis and commentary on legal developments in the sports industry. Founded in 2010 by Sean Cottrell, it serves a global community of over 30,000 members, including lawyers, sports executives, athletes, and academics. The blog features contributions from a distinguished editorial board of over 90 experts from more than 20 countries, ensuring high-quality, peer-reviewed content. LawInSport also offers a variety of resources such as articles, podcasts, videos, and professional courses to enhance knowledge and governance in sports law.
Facebook Followers 1.7KTwitter Followers 18.5K Frequency 4 posts/quarter

42. Intelligize Blog RSS Feed

Intelligize Blog RSS Feed intelligize.com/blog/feed   Follow RSS Blog intelligize.com
Covers a range of topics including Accounting, ESG, Investor Relations, IPO, M&A, News, Risk Factors, Rules & Regs, and SEC. Stay up to date with news & information from Intelligize, the leading provider in regulatory insights & tools for compliance.
Twitter Followers 444 Frequency 1 post/week Since Jan 2017

43. Michigan Auto Law Blog RSS Feed

Michigan Auto Law Blog RSS Feed michiganautolaw.com/feed   Follow RSS Blog michiganautolaw.com
A blog covering updates on changes in the auto law of the state. Articles are in the categories of Injuries, News, Car Insurance, Auto Safety, Attorney Resources, and Accidents. Michigan Auto Law helps people injured in car, truck, and motorcycle accidents throughout the state.
Facebook Followers 6KTwitter Followers 2.3KInstagram Followers 383 Frequency 1 post/month

44. European Law Blog RSS Feed

European Law Blog RSS Feed europeanlawblog.eu/feed   Follow RSS Blog europeanlawblog.eu
The European Law Blog provides expert analysis and commentary on current developments in EU law, authored by a diverse group of academics and practitioners. The blog, known for its concise and accessible style, covers a wide range of legal topics, including case law, legislation, and scholarly debates. Key contributors include Dr. Laurens Ankersmit, Dr. Maria Haag, Jasmin Hiry, Katie Nolan, and Marine Corhay, each bringing specialized knowledge in various aspects of EU law.
Twitter Followers 6.6K Frequency 8 posts/quarter Since Jan 2012

45. Lowering the Bar RSS Feed

Lowering the Bar RSS Feed loweringthebar.net/feed   Follow RSS Blog loweringthebar.net
Lowering the Bar is a unique legal humor blog authored by Kevin Underhill, a partner at Shook, Hardy & Bacon's San Francisco office. Underhill, known for his witty and analytical writing, launched the blog in 2005 to highlight the oddities and humorous aspects of the legal world. The blog features a wide range of topics, from bizarre lawsuits to strange legal precedents, all presented with a sharp comedic touch. Underhill's work has been featured in prestigious outlets like the Wall Street Journal and National Public Radio, showcasing his knack for blending humor with legal insight.
Twitter Followers 11.1K Frequency 4 posts/month

46. Davidson & Co Blog RSS Feed

Davidson & Co Blog RSS Feed davidsoncolaw.com/feed   Follow RSS Blog davidsoncolaw.com
Blog posts cover Legal Updates, Corporate/Commercial, Employment, Economy, Federal Law, Dispute Resolution, Banking & Finance, and Davidson & Co Updates. Davidson & Co is a boutique law firm with offices in Dubai and Geneva, specializing in providing uniquely commercial legal advice.
Facebook Followers 198Twitter Followers 996 Frequency 2 posts/month

47. Nonprofit Law Blog RSS Feed

Nonprofit Law Blog RSS Feed   Follow RSS Blog nonprofitlawblog.com
Nonprofit Law Blog is a specialized resource managed by Gene Takagi, the managing attorney of NEO Law Group, and offers valuable insights into legal matters affecting nonprofit organizations. Since its inception, the blog has been a go-to source for nonprofit professionals, providing expert analysis on corporate, tax, and charitable trust laws. Contributors to the blog include Erin Bradrick, Senior Counsel at NEO Law Group, and Michele Berger, a nonprofit attorney. The blog covers a wide range of topics, from governance and compliance to fundraising and social enterprise.
Twitter Followers 4.7K Frequency 2 posts/week

48. KJK RSS Feed

KJK RSS Feed kjk.com/feed   Follow RSS Blog kjk.com
Covers news related general to all businesses such as Corporate Law, Labor & Employment and Tax Law, and has categories tailored to specific industries, such as Esports & Entertainment, Construction & Trades, Real Estate, Health Care and more. KJK is an Ohio law firm serving businesses nationwide.
Facebook Followers 344Twitter Followers 225 Frequency 3 posts/week

49. Broadcast Law Blog RSS Feed

Broadcast Law Blog RSS Feed broadcastlawblog.com/feed   Follow RSS Blog broadcastlawblog.com
Broadcast Law Blog is a comprehensive resource managed by David Oxenford, a partner at Wilkinson Barker Knauer LLP. The blog provides insights into various legal issues pertinent to radio and television broadcasters, including FCC regulations, copyright, advertising, and digital media concerns. With over 30 years of experience, Oxenford represents a diverse clientele ranging from small family-owned stations to large noncommercial radio networks. He frequently speaks at industry conferences and offers expert commentary on broadcasting and music licensing issues.
Twitter Followers 1.1K Frequency 4 posts/week

50. My Shingle RSS Feed

My Shingle RSS Feed feeds.feedburner.com/MyShingle1   Follow RSS Blog myshingle.com
MyShingle is a pioneering blog founded in 2002 by Carolyn Elefant, dedicated to empowering solo and small law firm practitioners. With a wealth of resources including blog posts, e-books, and checklists, MyShingle provides practical guidance for lawyers looking to start or enhance their own practices. Carolyn Elefant, an accomplished attorney and author, is recognized as an ABA Legal Rebel and an advocate for small firms leveraging technology to compete with larger firms. Her work has significantly influenced the legal community, offering innovative solutions and support for solo practitioners.
Twitter Followers 13.6K Frequency 1 post/month

51. Diamond and Diamond Lawyers Blog RSS Feed

Diamond and Diamond Lawyers Blog RSS Feed diamondlaw.ca/feed   Follow RSS Blog diamondlaw.ca
Diamond and Diamond Lawyers is a personal injury law firm founded in 2005 in Ontario, Canada. The firm's mission is to provide compassionate and effective legal support for their clients and to ensure they receive fair compensation for their losses. The Diamond and Diamond Lawyers Blog offers helpful tips and resources.
Facebook Followers 4.3K Frequency 24 posts/year

52. Center For Art Law RSS Feed

Center For Art Law RSS Feed itsartlaw.org/feed   Follow RSS Blog itsartlaw.org
The Center for Art Law is a nonprofit organization that conducts research and offers resources & programming for the advancement of a vibrant arts & law community. Here, you'll get articles on Art Law, Book Reviews, Case Reviews, and Cultural Heritage.
Facebook Followers 2.3KTwitter Followers 3.4KInstagram Followers 5.1K Frequency 4 posts/month Since Apr 2013

53. TheCourt.ca RSS Feed

TheCourt.ca RSS Feed thecourt.ca/feed   Follow RSS Blog thecourt.ca
An online resource for debate & data about the Supreme Court of Canada. The goal is to be an inclusive forum for academics, practitioners, and interested citizens to publish, review & discuss commentary on recent Supreme Court judgments, upcoming cases, current hearings, scholarly perspectives, practical insights, updates, and more.
Facebook Followers 1.1KTwitter Followers 6.1K Frequency 5 posts/quarter Since Jan 2007

54. Ghana Law Hub RSS Feed

Ghana Law Hub RSS Feed ghanalawhub.com/feed   Follow RSS Blog ghanalawhub.com
Ghana Law Hub exists to create and encourage the creation of timely, relevant and authentic Ghanaian legal resources. To this end, the Hub aims at detailing key and major events and developments in the legal arena from as many perspectives as possible.
Facebook Followers 10.6K Frequency 1 post/month Since Apr 2017

55. Patrick Daniel Law RSS Feed

Patrick Daniel Law RSS Feed patrickdaniellaw.com/feed   Follow RSS Blog patrickdaniellaw.com
Patrick Daniel Law is based in Houston, TX and has experience in Agricultural Injury, Maritime Law, Medical Malpractice, Defective Product Lawsuits, Automobile and Trucking Accident Litigation and Various other types of personal injury actions.
Facebook Followers 827Twitter Followers 2.9KInstagram Followers 21.8K Frequency 2 posts/month

56. KnowLaw RSS Feed

KnowLaw RSS Feed knowlaw.in/index.php/feed   Follow RSS Blog knowlaw.in
KnowLaw stands as a pioneering educational platform, dedicated to serving law aspirants, students, and mentors. Its unwavering mission revolves around providing accessible and engaging resources, enhancing the legal education experience for everyone in the legal fraternity.
Facebook Followers 108Twitter Followers 22Instagram Followers 2.1K Frequency 2 posts/month Since Feb 2020

57. Frost Law News RSS Feed

Frost Law News RSS Feed   Follow RSS Blog askfrost.com
Articles feature insights and tips for Tax Law, Business Law, Bankruptcy Law & Estate Law trends. Frost & Associates, LLC is comprised of dedicated tax attorneys and other tax professionals navigating the toughest international and domestic tax issues.
Facebook Followers 1.5K Frequency 2 posts/month

58. The Malaysian Lawyer RSS Feed

The Malaysian Lawyer RSS Feed themalaysianlawyer.com/feed   Follow RSS Blog themalaysianlawyer.com
The Malaysian Lawyer is a collaborative blog by two lawyers, Lee Shih & Marcus van Geyzel. We set out updates on certain areas of Malaysian law. Key topics covered are company law, corporate rescue, insolvency, judicial management, restructuring, and more.
Frequency 2 posts/quarter Since Oct 2015

59. Kluwer Competition Law Blog RSS Feed

Kluwer Competition Law Blog RSS Feed feeds.feedburner.com/Kluw..   Follow RSS Blog competitionlawblog.kluwercompetitionlaw.com
The Kluwer Competition Law Blog is a leading platform for insights and updates on international competition and antitrust law, featuring contributions from a distinguished group of legal experts, including practicing lawyers, academics, and economists. The blog is managed by an editorial team comprising Peter Citron, Lena Hornkohl, and Alba Ribera Martínez, among others. It covers significant cases, policy developments, and legislative changes, offering timely and high-quality analysis to its readers.
Facebook Followers 32.3KTwitter Followers 18.3K Frequency 2 posts/week

60. Parker Poe News RSS Feed

Parker Poe News RSS Feed   Follow RSS Blog parkerpoe.com
Stay up on Parker Poe's latest news & insights, client alerts, outside publications, and media mentions. Parker Poe represents Southeast's largest companies and local governments in transactions, regulatory issues, and complex litigation.
Facebook Followers 745Twitter Followers 1.2K Frequency 22 posts/month

61. Vanguard Law Magazine Blog RSS Feed

Vanguard Law Magazine Blog RSS Feed   Follow RSS Blog vanguardlawmag.com
Vanguard is a digital publication that showcases the incredible diversity of the modern in-house counsel, highlighting the philosophies, strategies, and initiatives of attorneys from around the world. Vanguard takes a deep dive into these complex and ever-evolving roles, giving you, the reader, an inside look at how some of the world's biggest companies navigate shifting legal terrain.
Facebook Followers 359Twitter Followers 66 Frequency 4 posts/quarter

62. Golding & Golding Blog RSS Feed

Golding & Golding Blog RSS Feed irsstreamlinedprocedures.com..   Follow RSS Blog irsstreamlinedprocedures.com
An International Tax Blog featuring the latest articles, news & updates. We are International Tax Lawyers for Taxpayers worldwide.
Frequency 7 posts/month

63. Constitutional Law Reporter RSS Feed

Constitutional Law Reporter RSS Feed constitutionallawreporter.co..   Follow RSS Blog constitutionallawreporter.com
The Constitutional Law Reporter is an authoritative blog that delves into key issues and developments in U.S. constitutional law. Managed by Donald Scarinci, a seasoned constitutional law attorney and managing partner at Scarinci Hollenbeck, the blog offers in-depth analyses of Supreme Court cases, constitutional amendments, and historical legal milestones. Scarinci, a well-respected legal expert, frequently updates the blog with insightful commentary, making it a valuable resource for legal professionals, scholars, and anyone interested in constitutional law.
Facebook Followers 1.9KTwitter Followers 7.2K Frequency 3 posts/month

64. Canadian Labour and Employment Law RSS Feed

Canadian Labour and Employment Law RSS Feed labourandemploymentlaw.com/feed   Follow RSS Blog labourandemploymentlaw.com
Baker & McKenzie's Canadian Labour and Employment Law blog provides employers with up to date information on legal developments that impact workplace policies and procedures, human resources management, employment agreements, discipline and dismissal, and employment-related litigation.
Facebook Followers 23.9KTwitter Followers 249 Frequency 1 post/quarter

65. The Sam Bernstein Law Firm RSS Feed

The Sam Bernstein Law Firm RSS Feed callsam.com/feed   Follow RSS Blog callsam.com/blog
Blog features Articles on Vehicle Accidents, Serious Injuries, Medical Issues, and more. The Sam Bernstein Law Firm is a personal injury law firm that provides legal help to accident victims across the state of Michigan.
Facebook Followers 35KTwitter Followers 1.8K Frequency 1 post/month

66. Legal Mosaic Blog RSS Feed

Legal Mosaic Blog RSS Feed legalmosaic.com/feed   Follow RSS Blog legalmosaic.com
Legal Mosaic, founded by Mark A. Cohen, is a blog dedicated to modernizing the legal industry through thought leadership, consulting, and educational content. Cohen, an influential figure in legal innovation, has a diverse background as a former Assistant U.S. Attorney, BigLaw partner, and founder of legal enterprises like Clearspire. The blog features insights on the intersection of law, business, and technology, aiming to enhance legal service delivery and integrate legal functions with business needs.
Twitter Followers 6.8K Frequency 1 post/quarter

67. TechnoLlama RSS Feed

TechnoLlama RSS Feed feeds2.feedburner.com/Techno..   Follow RSS Blog technollama.co.uk
TechnoLlama is a blog managed by Dr. Andrés Guadamuz, a Senior Lecturer in Intellectual Property Law at the University of Sussex. The blog delves into various cyberlaw topics with a focus on artificial intelligence, internet regulation, and cryptocurrencies, often presenting complex issues in an approachable, light-hearted manner. Dr. Guadamuz is known for his engaging writing style and his expertise in the intersection of technology and law. TechnoLlama has garnered a dedicated readership for its insightful and accessible commentary on contemporary legal issues in the digital realm.
Facebook Followers 328Twitter Followers 10.5KInstagram Followers 341 Frequency 1 post/week

68. Sandberg Phoenix » Employer Law RSS Feed

Sandberg Phoenix » Employer Law RSS Feed sandbergphoenix.com/perspect..   Follow RSS Blog sandbergphoenix.com
Employer Law Blog has been helping business people navigate employment law. Recognizing that every business with employees faces challenges that can impact their growth and profitability, Sandberg Phoenix attorneys are committed to sharing their knowledge of, experience with and passion for employment law.
Facebook Followers 809Twitter Followers 434 Frequency 1 post/week

69. California Peculiarities Employment Law Blog RSS Feed

California Peculiarities Employment Law Blog RSS Feed calpeculiarities.com/feed   Follow RSS Blog calpeculiarities.com
California Peculiarities Employment Law Blog covers legislative updates & commentary on employer laws in CA including harassment & wage statements. The Seyfarth California Peculiarities Employment Law Blog is a unique - and peculiarities - of California employment law. This blog is for in-house attorneys, HR professionals, business owners, and managers who face real issues on a daily basis and need practical solutions to address them.
Facebook Followers 990Twitter Followers 9.8K Frequency 1 post/week

70. Simple Justice RSS Feed

Simple Justice RSS Feed blog.simplejustice.us/feed   Follow RSS Blog blog.simplejustice.us
Simple Justice is a well-regarded blog managed by Scott H. Greenfield, a seasoned criminal defense attorney. The blog offers insightful commentary on legal issues, criminal justice reform, and broader societal matters. Greenfield, who practices law in New York, uses his platform to critique the legal system and advocate for justice and fairness. His writing is known for its candid and often provocative style, engaging readers in deep discussions about law and ethics. The blog includes contributions from various legal experts and commentators who provide diverse perspectives on contemporary legal issues. Simple Justice is also noted for its active and thoughtful comment section, where readers engage in robust debates. Over the years, Greenfield's blog has become a key resource for legal professionals and anyone interested in the intersection of law and society.
Twitter Followers 19.9K Frequency 1 post/day

71. Acumen Law Corporation Blog RSS Feed

Acumen Law Corporation Blog RSS Feed vancouvercriminallaw.com/fee..   Follow RSS Blog vancouvercriminallaw.com
Blog of Acumen Law Corporation dealing mainly with IRP DUI law & developments in drunk driving law. Acumen Law Corporation is a Vancouver Criminal Law Firm that helps people who are facing criminal charges, DUI or driving prohibitions in British Columbia, Canada.
Facebook Followers 1.3KTwitter Followers 3K Frequency 2 posts/month

72. Cohn Legal, PLLC Blog RSS Feed

Cohn Legal, PLLC Blog RSS Feed cohnlg.com/feed   Follow RSS Blog cohnlg.com/blog
Our goal is to provide our clients with exceptional legal guidance and support at cost-effective rates. While excellence in legal representation is a given, we take greater pride in our ability to forge lasting bonds with our clients.
Frequency 1 post/day

73. Talk Left RSS Feed

Talk Left RSS Feed talkleft.com/index.xml   Follow RSS Blog talkleft.com
TalkLeft, founded by criminal defense attorney Jeralyn Merritt in 2000, is a liberal blog focused on crime-related political news and justice issues. Merritt, who has extensive legal experience, has covered notable trials and collaborated with prominent legal commentators. The blog has received multiple awards and has been featured in Newsweek Online, offering in-depth analysis and commentary on criminal justice topics.
Facebook Followers 760Twitter Followers 781 Frequency 3 posts/month

74. SeiferFlatow, PLLC Blog RSS Feed

SeiferFlatow, PLLC Blog RSS Feed seiferflatowlaw.com/feed   Follow RSS Blog seiferflatowlaw.com
Keep up with articles from SeiferFlatow.
Twitter Followers 641Instagram Followers 445 Frequency 4 posts/quarter

75. The Fearless Advocate RSS Feed

The Fearless Advocate RSS Feed fizzlaw.com/news/feed   Follow RSS Blog thefearlessadvocate.com
FizzLaw is an attorney blog (blawg) platform that enables lawyers & legal professionals to publish legal content. Our lawyer guest blogging platform is incredibly easy to manage and intuitive, making it easy to publish a legal article on topics that are relevant to your practice.
Frequency 3 posts/week

76. Legal Planet RSS Feed

Legal Planet RSS Feed legal-planet.org/feed   Follow RSS Blog legal-planet.org
Legal Planet provides insight and analysis on energy and environmental law. Our goal is to fill a unique space in the blogosphere. We write about court decisions, regulatory actions, and state and legislation that affect climate change policy, water resource management, toxic waste disposal, renewable energy, air quality, land use, and more.
Twitter Followers 2.2K Frequency 2 posts/day Since Jan 2009

77. BC Injury Law RSS Feed

BC Injury Law RSS Feed feeds.feedburner.com/IcbcLaw   Follow RSS Blog bc-injury-law.com
BC Injury Law is a blog managed by Erik Magraken, a personal injury lawyer at the MacIsaac Group of Law Firms. The blog provides detailed legal insights and updates on personal injury law in British Columbia, focusing on topics such as ICBC claims, negligence, and the application of various legal principles in injury cases. With a commitment to educating the public and other legal professionals, BC Injury Law covers a wide range of issues, including the nuances of motor vehicle accident claims, the impact of new legislation, and significant court rulings.
Facebook Followers 170Twitter Followers 7K Frequency 1 post/quarter

78. Futeral & Nelson, LLC Blog RSS Feed

Futeral & Nelson, LLC Blog RSS Feed charlestonlaw.net/feed   Follow RSS Blog charlestonlaw.net
The Charleston Law Blog, managed by the Futeral & Nelson law firm, offers a wealth of information on various legal topics pertinent to South Carolina, including DUI laws, defamation, family law, and more. The blog is authored primarily by Stephan Futeral, a seasoned attorney with extensive experience in family law, criminal defense, and personal injury cases. The blog aims to provide clear, practical legal advice and updates, making it a valuable resource for residents seeking to understand their legal rights and responsibilities.
Facebook Followers 1.7KTwitter Followers 1.1K Frequency 17 posts/year

79. Gravel2Gavel RSS Feed

Gravel2Gavel RSS Feed gravel2gavel.com/feed   Follow RSS Blog gravel2gavel.com
Gravel2Gavel is a comprehensive blog that delves into the complexities of construction and real estate law, published by the attorneys at Pillsbury Winthrop Shaw Pittman LLP. The blog provides detailed insights on a wide array of topics, including environmental regulations, real estate transactions, and construction industry trends. With contributions from an experienced editorial team, such as Emily Bias, Editor-in-Chief, and legal experts like Stephan E. Becker and Julia Kalinina Belcher, Gravel2Gavel is a valuable resource for professionals navigating the legal landscape of construction and real estate.
Twitter Followers 2.4K Frequency 5 posts/month

80. Louisiana Law Blog RSS Feed

Louisiana Law Blog RSS Feed louisianalawblog.com/feed   Follow RSS Blog louisianalawblog.com
Insight and Information on Louisiana law, litigation, and legal culture. Kean Miller LLP serves as legal counsel to the people and industries that drive the regional economy and provide efficient and effective legal services in a cost-efficient manner.
Facebook Followers 1.3KTwitter Followers 436 Frequency 2 posts/month

81. Minick Law Blog RSS Feed

Minick Law Blog RSS Feed minicklaw.com/feed   Follow RSS Blog minicklaw.com
Minick Law's Legal Blog attempts to address common questions, to help you in your search for answers and general information about the legal process.
Facebook Followers 160Twitter Followers 42 Frequency 1 post/week

82. Global IP & Technology Law Blog RSS Feed

Global IP & Technology Law Blog RSS Feed iptechblog.com/feed   Follow RSS Blog iptechblog.com
The Global IP & Technology Law Blog, hosted by Squire Patton Boggs, provides comprehensive coverage of significant developments in intellectual property and IT law. Edited by Tamara Fraizer, Simon Jones, and Joseph Grasser, the blog features insights on trademark protection, patent prosecution, trade secrets, data protection, privacy, and media issues. It serves as a crucial resource for businesses navigating the global economy's legal landscape, offering up-to-date news and expert analysis.
Facebook Followers 3.2KTwitter Followers 12KInstagram Followers 3.4K Frequency 1 post/week Since Oct 2013

83. Top Legal Firm RSS Feed

Top Legal Firm RSS Feed toplegalfirm.org/feed   Follow RSS Blog toplegalfirm.org
Top Legal Firm is a comprehensive blog offering valuable legal insights and practical advice across various fields of law, including personal injury, criminal defense, family law, and more. The blog is managed by a team of experienced legal professionals who provide up-to-date information on recent legal developments, case studies, and legal strategies. Key contributors include Brandon Price and other legal experts who share their knowledge to help readers understand and navigate complex legal issues.
Frequency 4 posts/day Since Jul 2020

84. Labor & Employment Law Blog RSS Feed

Labor & Employment Law Blog RSS Feed feeds.lexblog.com/laboremplo..   Follow RSS Blog laboremploymentlawblog.com
The Sheppard Mullin Labor & Employment Law Blog is designed to provide employers breaking news, insights & legal analysis on issues facing employers today. Key topics covered are Antitrust, Cannabis Law, Corporate Governance, Employee Benefits, FEHA, Immigration, Retaliation, and Workers Compensation.
Facebook Followers 1.4KTwitter Followers 3.6K Frequency 1 post/day

85. Bressler Risk Blog RSS Feed

Bressler Risk Blog RSS Feed bresslerriskblog.com/feed   Follow RSS Blog bresslerriskblog.com
Focusing on law firm risk management: trends, challenges, conflicts, compliance, technology, information security, ethics & more.
Twitter Followers 36 Frequency 4 posts/week

86. JCA Law Office Blog RSS Feed

JCA Law Office Blog RSS Feed filipinolawyer.ca/feed   Follow RSS Blog filipinolawyer.ca
JCA Law Office provides assistance on Filipino Immigration, Real Estate Closings, NBI Clearance, NSO certificates, and other legal services.
Facebook Followers 8.1KTwitter Followers 54 Frequency 13 posts/year

87. Customs & International Trade Law RSS Feed

Customs & International Trade Law RSS Feed customsandinternationaltrade..   Follow RSS Blog customsandinternationaltradelaw.com
Customs & International Trade Law Blog, managed by Diaz Trade Law, provides valuable insights into the complex world of customs and international trade laws. Authored by Jennifer Diaz, a board-certified international attorney and president of Diaz Trade Law, the blog covers topics such as U.S. customs regulations, trade compliance, and import/export controls. The editorial team includes experienced legal professionals who regularly engage with federal agencies to help clients navigate legal challenges and remain competitive in the marketplace.
Facebook Followers 995Twitter Followers 358Instagram Followers 304 Frequency 3 posts/week

88. Leading As Lawyers Blog RSS Feed

Leading As Lawyers Blog RSS Feed leadingaslawyers.blog/feed   Follow RSS Blog leadingaslawyers.blog
A Place for the Discussion of Leadership and Leadership Development for Lawyers, Law Students and Legal Educators
Frequency 3 posts/month

89. Workplace Class Action Blog RSS Feed

Workplace Class Action Blog RSS Feed workplaceclassaction.com/feed   Follow RSS Blog workplaceclassaction.com
Workplace Class Action Blog is devoted to the needs of corporate employers confronting the challenges of complex workplace litigation. Our team of bloggers at Seyfarth are complex workplace litigation practitioners who provide advisory, litigation, and transactional legal services.
Facebook Followers 981Twitter Followers 1.2K Frequency 2 posts/week

90. The McKinney Law Firm RSS Feed

The McKinney Law Firm RSS Feed themckinneylawfirm.com/texas..   Follow RSS Blog themckinneylawfirm.com
Covers issues and developments in federal and Texas employment law, including wrongful termination, sexual harassment, discrimination, and retaliation news and cases. McKinney Law Firm is a firm that focuses on the most serious Employment Rights & Workplace Injury cases.
Twitter Followers 2.8K Frequency 4 posts/month

91. The Last Word RSS Feed

The Last Word RSS Feed rudrajyotinathray.com/feed   Follow RSS Blog rudrajyotinathray.com
The Last Word' seeks to include not only wise and witty sayings of the judges but also curiosities of lawyers and the law. This blog is not of obligation but of delight. I frankly confess my ignorance of much that ought to be included from overseas jurisdictions, and I utter a gentle prayer that those who know better would lighten my darkness.
Frequency 2 posts/week Since Dec 2014

92. The Law Offices of Gary I. Handin Blog RSS Feed

The Law Offices of Gary I. Handin Blog RSS Feed handinlaw.com/feed   Follow RSS Blog handinlaw.com
Gary I. Handin, PA., is dedicated to providing exceptional legal representation to each and every client we serve. Our success has been directly linked to our proven ability to provide professional, personalized and compassionate service. Get updated on your legal knowledge with the Gary I. Handin, P.A. legal updates and news page and articles.
Frequency 1 post/week

93. Koehler Law Blog RSS Feed

Koehler Law Blog RSS Feed koehlerlaw.net/feed   Follow RSS Blog koehlerlaw.net
Koehler Law defends people charged with criminal offenses in D.C., Arlington, and Alexandria. On the blog, author and attorney, Jamison Koehler shares stories and experiences as a Criminal lawyer. He also talks about current legal issues and high-profile public cases and engages readers in playful, entertaining yet informative ways.
Facebook Followers 91Twitter Followers 1.6K Frequency 5 posts/quarter

94. Sim & Rahman Blog RSS Feed

Sim & Rahman Blog RSS Feed simrahman.com/feed   Follow RSS Blog simrahman.com
Sim & Rahman is a law firm in Setia Alam, Malaysia ready to serve you and provide legal advice to meet your legal needs.
Frequency 9 posts/quarter Since Oct 2020

95. Grits for Breakfast RSS Feed

Grits for Breakfast RSS Feed gritsforbreakfast.blogspot.c..   Follow RSS Blog gritsforbreakfast.blogspot.com
Grits for Breakfast is a well-regarded blog focused on criminal justice issues in Texas, authored by Scott Henson. Henson, a seasoned advocate and expert in criminal justice reform, uses the blog to provide insightful analysis and commentary on various aspects of the criminal justice system, including prison conditions, police practices, and legislative developments. Since its inception, the blog has earned numerous accolades, such as the 2004 Koufax Award for Best Single Issue Blog and the 2009 Austin Chronicle 'Best of Austin' Award. Grits for Breakfast is celebrated for its thorough research, balanced perspectives, and impactful reporting, making it a go-to resource for those interested in Texas criminal justice reform.
Twitter Followers 7.6K Frequency 6 posts/year

96. Healthcare Law Insights RSS Feed

Healthcare Law Insights RSS Feed healthcarelawinsights.com/feed   Follow RSS Blog healthcarelawinsights.com
The Healthcare Law Insights blog, managed by Husch Blackwell LLP, provides expert analysis on healthcare regulations, compliance, and industry trends. The blog features contributions from leading healthcare attorneys like Bruce Arnold, Curt Chase, and Cori Turner. These experts offer insights on a wide range of topics, including hospital-physician strategic alignment, healthcare joint ventures, and compliance with the Stark Law and Anti-Kickback Statute. The blog aims to help healthcare providers navigate the complex legal landscape and stay informed about critical legal issues.
Twitter Followers 711Instagram Followers 2.5K Frequency 2 posts/month

97. Joshua Wu Kai-Ming RSS Feed

Joshua Wu Kai-Ming RSS Feed joshuawu.my/feed   Follow RSS Blog joshuawu.my
Keep up with the articles on Law, Politics, Religion from Joshua Wu Kai-Ming.
Frequency 1 post/month

98. Law Truly RSS Feed

Law Truly RSS Feed lawtruly.com/feed   Follow RSS Blog lawtruly.com
Law Truly is a website dedicated to providing quality legal information to legal practitioners and others. For Lawyers, law and law practice are constantly changing making it imperative for legal practitioners to keep up with the change.
Frequency 1 post/month Since Dec 2019

99. Understanding the ADA RSS Feed

Understanding the ADA RSS Feed understandingtheada.com/feed   Follow RSS Blog understandingtheada.com
ADA legal consultant William D. Goren provides consultation, legal research and writing and counsels on cases involving compliance with the Americans with Disabilities Act (ADA) and the Rehabilitation Act of 1973.
Frequency 1 post/week

100. Bailey & Galyen Blog RSS Feed

Bailey & Galyen Blog RSS Feed thetexasattorney.com/feed   Follow RSS Blog thetexasattorney.com
Covers articles related to personal injuries and accidents, criminal defense, bankruptcy, family law and divorce, employment and labor law, social security and disability, and estate planning. The Texas Attorney brings four decades of hands-on experience to clients facing a wide range of legal challenges.
Facebook Followers 2Twitter Followers 2.1KInstagram Followers 800 Frequency 2 posts/week

101. Talkov Law Blog RSS Feed

Talkov Law Blog RSS Feed talkovlaw.com/feed   Follow RSS Blog talkovlaw.com
Talkov Law is dedicated to educating the public and keeping up with the latest legal developments through our blog. Our blog posts cover all of our practice areas, including real estate law, family law, bankruptcy law, business law, and trusts & probate law.
Facebook Followers 58Twitter Followers 21 Frequency 1 post/week Since Mar 2010

102. Disputing Blog RSS Feed

Disputing Blog RSS Feed disputingblog.com/feed   Follow RSS Blog disputingblog.com
Disputing is published by Karl Bayer, a dispute resolution expert based in Austin, Texas. Articles published on Disputing aim to provide original insight and commentary around issues related to arbitration, mediation, and the alternative dispute resolution industry.
Twitter Followers 975 Frequency 5 posts/year

103. The Legal Reports RSS Feed

The Legal Reports RSS Feed thelegalreports.com/feed   Follow RSS Blog thelegalreports.com
First and Leading legal news and media website in Uganda. At The legal reports, we make sure you are updated with all law and legal affairs in Uganda.
Facebook Followers 2.6KTwitter Followers 2.6K Frequency 8 posts/quarter

104. California Construction Law Blog RSS Feed

California Construction Law Blog RSS Feed calconstructionlawblog.com/feed   Follow RSS Blog calconstructionlawblog.com
At Nomos LLP, we've published this blog to keep everyone informed of new developments in construction law. From contract formation to contract disputes, we have the knowledge, expertise and pragmatism to take you from groundbreaking to ribbon cutting. Here are featured articles exclusively on Construction Law.
Facebook Followers 206Twitter Followers 175 Frequency 1 post/week

105. The Labor & Employment Law Blog RSS Feed

The Labor & Employment Law Blog RSS Feed thelelawblog.com/feed   Follow RSS Blog thelelawblog.com
The Labor and Employment Law blog is written by the Employment Lawyers at Weintraub Tobin law firm and discusses labor and employment topics, issues, and legal news. Weintraub Tobin is an innovative provider of sophisticated legal services to businesses and business owners throughout California.
Facebook Followers 448Twitter Followers 435 Frequency 2 posts/month

106. Lerners LLP RSS Feed

Lerners LLP RSS Feed lernerspersonalinjury.ca/ins..   Follow RSS Blog lernerspersonalinjury.ca
Lerners Personal Injury Law Firm blog provides updated information about personal injury law in Toronto & London, Ontario.
Facebook Followers 1.8KTwitter Followers 1.9K Frequency 7 posts/quarter

107. Law 4 Small Business Blog RSS Feed

Law 4 Small Business Blog RSS Feed feeds.feedburner.com/L4SB   Follow RSS Blog l4sb.com/blog
The Law 4 Small Business (L4SB) blog is a valuable resource for entrepreneurs and small business owners, offering expert legal advice and practical tips on managing and protecting their businesses. The blog covers a wide range of topics, including business formation, intellectual property, contracts, and legal compliance, ensuring that readers stay informed about essential legal matters. Through its posts, L4SB aims to simplify complex legal issues and provide actionable insights for business success.
Facebook Followers 2KTwitter Followers 233 Frequency 1 post/week

108. Wise Law Blog RSS Feed

Wise Law Blog RSS Feed wiselaw.blogspot.com/feeds/p..   Follow RSS Blog wiselaw.blogspot.com
Legal headlines and opinions from Toronto employment lawyer, Garry J. Wise and the lawyers of Wise Law Office, Toronto, Ontario.
Facebook Followers 173Twitter Followers 2.4K Frequency 2 posts/day Since Apr 2005

109. Fire Law Blog RSS Feed

Fire Law Blog RSS Feed firelawblog.com/feed   Follow RSS Blog firelawblog.com
Fire Law Blog, managed by Curt Varone, offers expert insights into legal issues affecting fire service and public safety. With over 45 years of fire service experience and 35 years as an attorney, Varone provides a unique perspective on cases involving firefighter rights, department regulations, and legal precedents shaping the fire industry. He has authored several books and is a contributing editor for Firehouse Magazine. The blog covers a wide range of topics, including employment law, constitutional issues, and safety regulations, making it an essential resource for fire service professionals.
Facebook Followers 8.1KTwitter Followers 1.5K Frequency 1 post/day

110. Stephens & Stephens Marital & Family Law RSS Feed

Stephens & Stephens Marital & Family Law RSS Feed eddiestephens.com/feed   Follow RSS Blog eddiestephens.com
A short concise summary of all Florida Family Law cases from 2005 - 2018 by Board Certified Divorce Attorney Eddie Stephens and selected published essays.
Facebook Followers 697Twitter Followers 422Instagram Followers 464 Frequency 3 posts/quarter Since Dec 2005

111. Who Is My Employee? RSS Feed

Who Is My Employee? RSS Feed whoismyemployee.com/feed   Follow RSS Blog whoismyemployee.com
On this website, we will explore the various legal standards used to determine Who Is My Employee? We will examine new developments, trends, changes in the law, strategies, tips, and whatever else comes to mind.
Twitter Followers 1.2K Frequency 3 posts/month

112. Houston Tax Attorney Blog RSS Feed

Houston Tax Attorney Blog RSS Feed irstaxtrouble.com/feed   Follow RSS Blog irstaxtrouble.com
We provide IRS audit and tax debt solutions for clients nationwide. This includes settling IRS tax debts and resolving unpaid tax liabilities. Our goal is to help reduce the time, confusion, and stress associated with federal and state tax matters.
Facebook Followers 930Twitter Followers 22 Frequency 1 post/week

113. Pennsylvania Labor & Employment Blog RSS Feed

Pennsylvania Labor & Employment Blog RSS Feed palaborandemploymentblog.com..   Follow RSS Blog palaborandemploymentblog.com
The McNees Labor & Employment Blog seeks to provide employers with operations in Pennsylvania with the latest updates, analysis, and commentary on how the law impacts employers at the national, state, and local level. Their attorneys cover topics including employment litigation, wage & hour issues, unions, social media, discrimination & harassment, employee benefits, and affirmative action.
Facebook Followers 694Twitter Followers 942 Frequency 1 post/month

114. Stephen Legal RSS Feed

Stephen Legal RSS Feed stephenlegal.ng/feed   Follow RSS Blog stephenlegal.ng
Stephen Legal is in the business of providing innovative legal insights and easy solution in this information age. It presents an online platform for people.
Facebook Followers 6KTwitter Followers 512 Frequency 2 posts/quarter Since Oct 2016

115. FDA Law Blog RSS Feed

FDA Law Blog RSS Feed fdalawblog.net/feed   Follow RSS Blog thefdalawblog.com
The FDA Law Blog offers expert commentary and analysis on regulatory issues, legal developments, and compliance matters related to the U.S. Food and Drug Administration (FDA). It covers a wide range of topics, including drug and device regulations, enforcement actions, legislative changes, and significant court rulings. Authored by experienced attorneys, the blog provides valuable insights and practical guidance for professionals navigating the complexities of FDA law, making it an essential resource for legal and regulatory affairs specialists in the pharmaceutical, biotech, and medical device industries.
Twitter Followers 4.7K Frequency 29 posts/year

116. Lawyer Issue RSS Feed

Lawyer Issue RSS Feed lawyerissue.com/feed   Follow RSS Blog lawyerissue.com
Lawyer Issue has a highly targeted international readership and is a great tool for global professionals. We aim to provide valued insight into the legal sector and shine a spotlight on many of the trending issues.
Twitter Followers 1.8K Frequency 2 posts/month

117. Five Minute Law Blog RSS Feed

Five Minute Law Blog RSS Feed fiveminutelaw.com/feed   Follow RSS Blog fiveminutelaw.com
'Why do you write like you're running out of time?'
Facebook Followers 85Twitter Followers 8.7K Frequency 4 posts/year

118. Tech Law Blog RSS Feed

Tech Law Blog RSS Feed irelandip.com/feed   Follow RSS Blog techlaw.ie
Ireland IP & Technology Law Blog provides the information you need to know about Intellectual property & technology law in Ireland. A&L Goodbody is an Irish law firm providing expert legal advice across every aspect of business law.
Facebook Followers 2.9KTwitter Followers 5.1K Frequency 1 post/month

119. Ohio Family Law Blog RSS Feed

Ohio Family Law Blog RSS Feed hcmmlaw.com/blog/feed   Follow RSS Blog hcmmlaw.com/blog
The Ohio Family Law Blog, authored by Robert 'Chip' Mues of Holzfaster, Cecil, McKnight & Mues, LPA, provides valuable insights on family law and divorce issues for Ohio families. With over four decades of experience, Mues brings extensive expertise in domestic relations litigation. The blog features contributions from esteemed colleagues like Joseph E. Balmer, head of Probate and Estate Planning, and Gary M. Hruska, a highly ethical counselor. The blog also includes guest posts from experts like Donna F. Ferber and Dr. Karen Finn, enriching its content with diverse perspectives.
Facebook Followers 361Twitter Followers 6.7KInstagram Followers 73 Frequency 1 post/week

120. Employment & Labor Insider Blog RSS Feed

Employment & Labor Insider Blog RSS Feed constangy.com/employment-lab..   Follow RSS Blog constangy.com
Employment & Labor Insider is a blog managed by Robin Shea, a partner at Constangy, Brooks, Smith & Prophete, LLP. The blog focuses on providing practical insights and updates on labor and employment law. With over 30 years of experience in employment litigation, Shea brings a wealth of knowledge on topics like discrimination, workplace policies, and compliance. The blog features contributions from a diverse editorial team, including experts like William A. 'Zan' Blue, Jr., and Obasi Bryant, making it a valuable resource for employers seeking to navigate complex legal landscapes.
Facebook Followers 598Twitter Followers 1.3K Frequency 2 posts/week

121. The Korean Law Blog RSS Feed

The Korean Law Blog RSS Feed thekoreanlawblog.com/feed/atom   Follow RSS Blog thekoreanlawblog.com
The Korean Law Blog, maintained by IPG Legal, offers comprehensive insights into Korean law, the legal system, and law firms in Korea. Authored by Sean Hayes, a notable figure as the first non-Korean attorney employed by the Korean court system, the blog delves into various legal topics ranging from corporate law to dispute resolution. Hayes, recognized as a Top 100 Lawyer, brings his extensive experience and candid approach to legal analysis, making the blog a valuable resource for legal professionals and international businesses.
Twitter Followers 679 Frequency 3 posts/week

122. Election Law Blog RSS Feed

Election Law Blog RSS Feed electionlawblog.org/?feed=rss2   Follow RSS Blog electionlawblog.org
The Election Law Blog, authored by Richard L. Hasen, provides expert analysis and commentary on election law, campaign finance regulation, and related political issues. Hasen, a professor at UCLA School of Law and director of the Safeguarding Democracy Project, has built the blog into a key resource for legal scholars, practitioners, and the public since its inception. The blog also features contributions from distinguished legal professionals and academics, ensuring a diverse and informed perspective on pressing election law matters.
Facebook Followers 1.7KTwitter Followers 94K Frequency 11 posts/day Since Sep 2003

123. Employers' Lawyers Blog RSS Feed

Employers' Lawyers Blog RSS Feed employerslawyersblog.com/feed   Follow RSS Blog employerslawyersblog.com
The Employers' Lawyers Blog offers the latest legal news and commentary on issues affecting today's employers. Their Labor and Employment team posts best practice tips, checklists and updates designed to keep organizations of all sizes in compliance with federal and state employment laws.
Twitter Followers 1.8K Frequency 4 posts/month

124. D.R. PATTI & ASSOCIATES RSS Feed

D.R. PATTI & ASSOCIATES RSS Feed vegaspifirm.com/index.php/feed   Follow RSS Blog vegaspifirm.com
D.R. Patti & Associates are Las Vegas trial lawyers handling personal injury, medical malpractice, business, DUI, and civil rights cases.
Facebook Followers 480Twitter Followers 25 Frequency 7 posts/month

125. Lester Aldridge RSS Feed

Lester Aldridge RSS Feed lesteraldridge.com/feed   Follow RSS Blog lesteraldridge.com
Lester Aldridge solicitors are a full service law firm with offices in Bournemouth, Southampton & London. Outstanding private & commercial legal advice. For Lester Aldridge news, developments and new legislation, our blog has everything you'll need to know to keep you up to date.
Facebook Followers 691Twitter Followers 1.7KInstagram Followers 1.3K Frequency 5 posts/month

126. Cardozo Arts & Entertainment Law Journal RSS Feed

Cardozo Arts & Entertainment Law Journal RSS Feed cardozoaelj.com/feed/?x=1   Follow RSS Blog cardozoaelj.com
The Cardozo Arts & Entertainment Law Journal (AELJ) blog, hosted by the Benjamin N. Cardozo School of Law, offers in-depth analyses on arts, entertainment, intellectual property, First Amendment, sports, fashion, cyberlaw, and media and telecommunications law. Established in 1982, AELJ is recognized for its scholarly impact both nationally and internationally. The journal is edited by a team of dedicated law students and regularly publishes articles, hosts symposia, and collaborates with organizations like the GRAMMY Foundation.
Facebook Followers 511Twitter Followers 942 Frequency 26 posts/year

127. Eloise Gratton RSS Feed

Eloise Gratton RSS Feed eloisegratton.com/feed   Follow RSS Blog eloisegratton.com
Eloise Gratton is a lawyer practicing in Privacy and IT Law. She also teaches at the Faculty of Law, University of Montreal. She is a partner at Borden Ladner Gervais LLP and National Co-Leader of the Privacy and Data Security Practice Group. She shares the latest news and updates about Privacy and IT law on her blog.
Twitter Followers 2.6K Frequency 20 posts/year

128. Inpractice | Business Development and Legal Technology for Law Firms RSS Feed

Inpractice | Business Development and Legal Technology for Law Firms RSS Feed inpractice.co.uk/feed/rss2   Follow RSS Blog inpractice.co.uk
Enabling lawyers to plan ahead to build a smarter business that stands out. Effective, innovative and competitive.
Twitter Followers 1.1K Frequency 2 posts/quarter

129. Law Daily RSS Feed

Law Daily RSS Feed blogger.com/feeds/3239069528..   Follow RSS Blog thelawdaily.blogspot.com
The Law Daily publishes articles related to the field of law throughout the year and aims towards accomodating every qualitative submission to create an open-access platform for legal news.
Instagram Followers 121 Frequency 1 post/quarter

130. ONE400 RSS Feed

ONE400 RSS Feed one-400.com/feed   Follow RSS Blog one400.com
ONE400 is a law innovation agency focusing on cutting edge websites and integrated marketing solutions for law firms and legal tech startups.
Facebook Followers 557Twitter Followers 2.7KInstagram Followers 353 Frequency 2 posts/quarter

131. Labour Pains RSS Feed

Labour Pains RSS Feed ottawaemploymentlaw.com/feed..   Follow RSS Blog ottawaemploymentlaw.com
An employment law blog for employers and employees. Published by Sean Bawden of Kelly Santini LLP. Sean P. Bawden is an experienced trial lawyer and trusted strategic advisor with respect to matters of employment law and commercial disputes. He is a partner with Kelly Santini LLP, located in Ottawa, Ontario, Canada.
Twitter Followers 5.1K Frequency 2 posts/quarter Since Apr 2012

132. Christensen Law Blog RSS Feed

Christensen Law Blog RSS Feed davidchristensenlaw.com/feed   Follow RSS Blog davidchristensenlaw.com
Auto accident blog Articles by David Christensen focusing on legal issues for car accident victims who suffer traumatic brain injury. Christensen Law is a preeminent Michigan law firm specializing in personal injury, traumatic brain injury (TBI), wrongful death, truck, car, and motorcycle accidents.
Facebook Followers 4.9KTwitter Followers 306 Frequency 16 posts/quarter

133. Boston Criminal Lawyer Blog RSS Feed

Boston Criminal Lawyer Blog RSS Feed bostoncriminallawyerblog.com..   Follow RSS Blog bostoncriminallawyerblog.com
Boston Criminal Lawyer Blog is published by Boston, Massachusetts Criminal Defense Attorneys, Altman and Altman. The blog provides updates on criminal cases. For over four decades, the law firm Altman and Altman, LLP has been providing outstanding criminal defence legal services to clients in Massachusetts and throughout New England. With decades of experience, their team of bright, aggressive, and hardworking criminal attorneys draw upon their broad base of expertise to provide their clients with the highest quality legal advice.
Facebook Followers 4Twitter Followers 2.8K Frequency 3 posts/year

134. Canadian Privacy Law Blog RSS Feed

Canadian Privacy Law Blog RSS Feed blog.privacylawyer.ca/feeds/..   Follow RSS Blog blog.privacylawyer.ca
Developments in privacy law and writings of a Canadian privacy lawyer, containing information related to the Personal Information Protection and Electronic Documents Act (aka PIPEDA) and other Canadian and international laws.
Twitter Followers 8K Frequency 6 posts/year Since Jan 2004

135. Pairokar RSS Feed

Pairokar RSS Feed parokar.blogspot.com/feeds/p..   Follow RSS Blog parokar.blogspot.com
Regular updates and news.
Frequency 1 post/month

136. A Winning Tip RSS Feed

A Winning Tip RSS Feed awinningtip.blogspot.com/fee..   Follow RSS Blog awinningtip.blogspot.com
A trial consultant for more than 20 years, I am also a psychologist, author and speaker. I have had the privilege of extensively studying how people think, make decisions and how they commit to those decisions.
Frequency 1 post/month Since Nov 2008

137. Joshua Rogala Blog RSS Feed

Joshua Rogala Blog RSS Feed winnipegcriminaldefencelawye..   Follow RSS Blog winnipegcriminaldefencelawyer.ca
Joshua Rogala's legal blog provides information about the law, Winnipeg news stories, and tid-bits of information that are both interesting and educational.
Twitter Followers 45 Frequency 1 post/quarter

138. Legal Edge Services Blog RSS Feed

Legal Edge Services Blog RSS Feed legaledgeservices.com/feed   Follow RSS Blog legaledgeservices.com
This blog for attorneys by Legal Edge Services features tips to help you to be more productive and proven ways to increase billable hours. Legal Edge Services is the premier provider of turn-key law office solutions for the legal community.
Facebook Followers 832 Frequency 5 posts/quarter

139. Legal Support World RSS Feed

Legal Support World RSS Feed legalsupportworld.blogspot.c..   Follow RSS Blog legalsupportworld.blogspot.com
Since 2008, Legal Support World has been offering legal outsourcing services and legal support solutions through innovative thought leaders who put forth their knowledge and experience to fulfill the individual expectations of each client. We are a leading, pure-play outsourcing company that helps clients augment their internal capabilities and retain superior quality and proficiency with utmost cost effectiveness.
Facebook Followers 743Twitter Followers 1.2K Frequency 1 post/day Since Nov 2014

140. Kuzyk Law Blog RSS Feed

Kuzyk Law Blog RSS Feed kuzyklaw.com/feed   Follow RSS Blog kuzyklaw.com
Kuzyk Law has served Lancaster, Palmdale & all of Antelope Valley for over 40 years.
Facebook Followers 1.2KTwitter Followers 39 Frequency 2 posts/month

141. Screw You Guys, I'm Going Home RSS Feed

Screw You Guys, I'm Going Home RSS Feed feeds.feedburner.com/Scre..   Follow RSS Blog employeeatty.blogspot.com
What You Need To Know Before You Scream 'I Quit, 'Get Fired, Or Decide to Sue the Bastards. Author Donna Ballman is an employee-side employment lawyer. She has built a reputation as a skilled and knowledgeable attorney in all of the aspects of labor and employment law. Follow to read her regular articles on employee-side employment law issues.
Facebook Followers 212Twitter Followers 6.5K Frequency 1 post/month Since Oct 2010

142. Ferragut Law Firm Blog RSS Feed

Ferragut Law Firm Blog RSS Feed ferragutlaw.com/feed   Follow RSS Blog ferragutlaw.com
Welcome to the Ferragut Law Firm, a top rated criminal defense attorney Phoenix Arizona, dedicated exclusively to the practice of criminal law in all state, federal, and city courts throughout the State of Arizona.
Frequency 23 posts/year

143. JDJournal RSS Feed

JDJournal RSS Feed jdjournal.com/feed   Follow RSS Blog jdjournal.com
JD Journal is a prominent online resource delivering the latest news and insights within the legal industry. As a comprehensive platform, it caters to a broad audience of legal professionals, law students, and academics. The blog is known for its in-depth analysis of current trends, profiles of leading figures in the legal field, and coverage of significant legal events worldwide. While specific details about the editorial team are not readily available, the blog's commitment to thorough and insightful reporting makes it a valuable resource for staying informed about the ever-evolving landscape of law.
Facebook Followers 153Twitter Followers 5K Frequency 30 posts/quarter

144. The Wall Street Journal » Law-Legal RSS Feed

The Wall Street Journal » Law-Legal RSS Feed   Follow RSS Blog wsj.com
Discover the latest and breaking Law news from The Wall Street Journal. The Wall Street Journal was founded in July 1889. Ever since, the Journal has led the way in chronicling the rise of industries in America and around the world. In no other period of human history has the planet witnessed changes so dramatic or swift.
Facebook Followers 7.3MTwitter Followers 20.7MInstagram Followers 5M

145. The Crime Report RSS Feed

The Crime Report RSS Feed thecrimereport.org/feed   Follow RSS Blog thecrimereport.org
The Crime Report is a comprehensive news and analysis platform dedicated to covering criminal justice issues in the United States. Managed by the Center on Media, Crime and Justice at John Jay College, it provides in-depth reporting on topics such as policing, sentencing, and prison reform. Founded with the goal of fostering informed public dialogue, the blog features contributions from leading journalists and experts in the field. The editorial team includes Managing Editor Nancy Bilyeau, Staff Writer TCR Staff, and contributing writers from diverse backgrounds.
Facebook Followers 6.4KTwitter Followers 16.6K Frequency 30 posts/year

146. O'Connor PhD Law Writers Blog RSS Feed

O'Connor PhD Law Writers Blog RSS Feed   Follow RSS Blog phdlawwriters.com
The PhD Law Writers Blog covers law dissertations, law case studies, research papers, etc. These posts share writing tips for several types of law assignments. PhD Law Writers is a dedicated team of individuals that provides reliable & trustworthy assignments of law academics for students all across the country.
Twitter Followers 6Instagram Followers 1.2K

147. 4M Legal and Tax Law Firm News RSS Feed

4M Legal and Tax Law Firm News RSS Feed 4mlegaltax.com/feed   Follow RSS Blog 4mlegaltax.com
Uncover the latest News & Insights illuminating the legal landscape. Read careful analyses, market reports, and other relevant stories. 4M Legal and Tax law firm is an experienced bilingual Law Firm in Douala, Cameroon, and offers full-service legal, regulatory, and tax solutions, bridging West and Central Africa.
Facebook Followers 23Twitter Followers 9 Frequency 9 posts/year

148. Remove Arrests Blog RSS Feed

Remove Arrests Blog RSS Feed   Follow RSS Blog remove-arrests.org
We offer a variety of services to clear your criminal record online. Our experienced internet removal experts use cutting-edge tools to identify everywhere your mugshot and arrest information shows up online. Our guaranteed mugshot removal solutions will get your mugshot and arrest record off websites and search engines like Google and Bing. We guarantee that any mugshots we remove won't be republished, protecting you from future online reputation-damage related to arrests.
Facebook Followers 999PinterestLinkedInYouTube Frequency 13 posts/year Popular Post Intelius vs. Radaris: A Comparative Review Get Contact

149. Reuters » Legal RSS Feed

Reuters » Legal RSS Feed   Follow RSS Blog reuters.com
Reuters, the news and media division of Thomson Reuters, is the world's largest multimedia news provider, reaching billions of people worldwide every day. Reuters provides business, financial, national, and international news to professionals via desktop terminals, the world's media organizations, industry events, and directly to consumers.
Facebook Followers 7.1MTwitter Followers 25.8MInstagram Followers 5M

150. Rocket Lawyer RSS Feed

Rocket Lawyer RSS Feed   Follow RSS Blog rocketlawyer.com
Everyday Law helps you identify the ways the law can make your life better. Find tips about timely legal topics and learn how people like you manage their issues. Rocket Lawyer makes the law work for you at a price you can afford.
Facebook Followers 27.9KTwitter Followers 14.1K

151. Latham & Watkins LLP RSS Feed

Latham & Watkins LLP RSS Feed   Follow RSS Blog lw.com
Latham & Watkins is a global law firm with more than 3,000 lawyers in its offices located in Asia, Europe, the Middle East, and the United States. The firm has internationally recognized practices in a wide spectrum of transactional, litigation, corporate and regulatory areas. Our success is grounded in our devotion to the collaborative process, which reaches across global offices and practices and draws upon our deep subject matter expertise, an abiding commitment to teamwork, and a powerful tradition of creative lawyering.
Facebook Followers 10.8KTwitter Followers 38KInstagram Followers 7.3K

152. The Fashion Law RSS Feed

The Fashion Law RSS Feed   Follow RSS Blog thefashionlaw.com
The Fashion Law is a leading platform offering detailed insights into the intersection of fashion, business, and law. It provides expert analysis on legal disputes, trademark cases, intellectual property rights, and sustainability issues within the fashion industry. With coverage on emerging trends, brand strategies, and regulatory changes, the platform serves as a critical resource for fashion professionals, legal experts, and business leaders. Through in-depth reporting, The Fashion Law helps navigate the complexities of fashion's evolving legal landscape, offering actionable information on both creative and commercial challenges.
Facebook Followers 19.7KTwitter Followers 106.3KInstagram Followers 167K Since Jan 2014

153. The Biglaw Investor Blog RSS Feed

The Biglaw Investor Blog RSS Feed biglawinvestor.com/feed   Follow RSS Blog biglawinvestor.com
The Biglaw Investor is a finance and investing blog for smart lawyers who want to build wealth and achieve financial independence. Topics covered are Asset Protection, Financial Independence, Investing, Taxes, and Loans.
Twitter Followers 4.1KInstagram Followers 745 Frequency 1 post/year Since May 2016

154. Blumberg Blog RSS Feed

Blumberg Blog RSS Feed blog.blumberg.com/index.php/..   Follow RSS Blog blog.blumberg.com
Serving the legal community since 1887. This blog is prepared for general information purposes to permit you to learn more about our company, our products & services, and the events affecting our business community. We cover Legal Supplies, Marketing Services, Legal Pads, Tax Information, Corporate Seals, and Publication Services.
Twitter Followers 326 Since Oct 2020

155. Dezan Shira & Associates RSS Feed

Dezan Shira & Associates RSS Feed dezshira.com/feed   Follow RSS Blog dezshira.com
Keep up with our regular insights & thought leadership regarding economic regulatory & operating conditions, upcoming events, webinars, and more. Dezan Shira & Associates is a multi-disciplinary professional services firm, providing legal, tax, and operational advisory to international corporate investors operational throughout China, ASEAN, and India.
Facebook Followers 1.4KTwitter Followers 1.5K

156. Chugh LLP News RSS Feed

Chugh LLP News RSS Feed chugh.com/feed   Follow RSS Blog chugh.com/news
Covers Accounting, Arbitration Clause, California Law, Contract law, Data Privacy, Hotel Law, Immigration, Family Law, Tax Law, and Workplace Inspections. Chugh, LLP is a full-service Law & CPA Firm specializing in Immigration, Corporate, Taxation, Litigation, and Employment with offices in the USA & India.
Facebook Followers 12.4KTwitter Followers 7.6KInstagram Followers 614 Since May 2020

157. CL&P Blog RSS Feed

CL&P Blog RSS Feed pubcit.typepad.com/clpblog/i..   Follow RSS Blog pubcit.typepad.com
Updates and ideas about consumer law and policy by lawyers and law professors. The blog is hosted by the Public Citizen Litigation Group.

158. Probate Stars RSS Feed

Probate Stars RSS Feed probatestars.com/feed   Follow RSS Blog probatestars.com
Probate Stars is the most comprehensive collection of information about probate, trusts, estate planning, guardianships, and inheritance litigation on the web. We provide a platform to connect people with legal problems with qualified lawyers in their region.
Facebook Followers 35 Frequency 30 posts/year

159. Truth Legal RSS Feed

Truth Legal RSS Feed truthlegal.com/latest-news/feed   Follow RSS Blog truthlegal.com
Truth Legal pursues justice. We strive to provide the most caring, thorough and individual personal injury, employment, clinical negligence legal representation available. Truth Legal Solicitors are an ethical, tenacious and affordable law firm.
Facebook Followers 531Twitter Followers 2.1K

160. Law with Shaheen RSS Feed

Law with Shaheen RSS Feed lawwithshaheen.com/feed   Follow RSS Blog lawwithshaheen.com
Learn Law To Protect Your Rights
Twitter Followers 113

161. In House Blog RSS Feed

In House Blog RSS Feed   Follow RSS Blog inhouseblog.com
InhouseBlog® and its job board, GoInhouse®, are owned and operated by Law Department Solutions, LLC. InhouseBlog was co-founded by Geoffrey Gussis (LinkedIn), who serves as Managing Editor, and Amar Maktal (LinkedIn), who serves as Chief Technologist. InhouseBlog® was selected as a Top 100 Blawg by the ABA Journal (2008), nominated as a Top 25 Business Law Blog by LexisNexis (2010), selected as the Runner-Up for the Best Practice Specific Blawg in Dennis Kennedy's 2011 Blawggie Awards and 2013 Blawggie Awards, and won the Best Practice Specific Blawg in those awards in 2014 and 2015.
Frequency 3 posts/year

162. The Law Office of Gaynell Williams LLC Blog RSS Feed

The Law Office of Gaynell Williams LLC Blog RSS Feed gaynellwilliamslaw.com/blog-..   Follow RSS Blog gaynellwilliamslaw.com
As a New Orleans-based law firm, the experienced criminal defense lawyers at Gaynell Williams, LLC represent clients who have been arrested on misdemeanor charges, drug charges, property and theft charges, DWI/DIU charges, federal charges, and white-collar crime charges to name a few. Each criminal defense attorney in their office tailors their aggressive representation to fit each client's criminal defense needs and works with the top investigators and experts in the field to make sure that no stone is left unturned and no avenue of defense is left unexplored.
Facebook Followers 495Twitter Followers 18Instagram Followers 268 Frequency 3 posts/year

163. Legal Theory Blog RSS Feed

Legal Theory Blog RSS Feed lsolum.typepad.com/legaltheo..   Follow RSS Blog lsolum.typepad.com
Blog articles focus on legal theory and its interpretation in the current era. Lawrence Solum is a Law Professor at University of Virginia, JD Harvard Law, and teaches Originalism, virtue jurisprudence, AI, normative legal theory.
Twitter Followers 11.5KInstagram Followers 1.6K Since Sep 2002

164. Law And More | Deconstructing What Happens in Law RSS Feed

Law And More | Deconstructing What Happens in Law RSS Feed lawandmore.typepad.com/law_a..   Follow RSS Blog lawandmore.typepad.com
Jane Genova is the creator of the Law And More blog, where she deconstructing what happens in law. She helps you sell yourself to your target markets (including future employers).

165. Making Your Mark blog RSS Feed

Making Your Mark blog RSS Feed trademarkandcopyrightlawblog..   Follow RSS Blog foleyhoag.com
Perspectives & Legal developments in Trademarks, Copyrights, Domain Disputes, Unfair Competition, and more. Some sub-topics cover Criminal Liability, Defamation, Right of Publicity, Privacy, and Licensing. Authored by Lawyers of Foley Hoag Law Firm.
Facebook Followers 798Twitter Followers 3.2K Frequency 4 posts/year Since Mar 2010

166. New York Personal Injury Law Blog RSS Feed

New York Personal Injury Law Blog RSS Feed feeds.feedburner.com/NewY..   Follow RSS Blog newyorkpersonalinjuryattorneyblog.com
New York Personal Injury Law Blog by Eric Turkewitz, is an attorney's blog on New York personal injury law, medical malpractice, the civil justice system and cases of interest. Eric Turkewitz has tried personal injury cases to verdict in New York, Bronx, Brooklyn, Queens, Staten Island, Nassau, Suffolk, Westchester, Rockland, Dutchess and Albany counties. He has argued appeals in the the Second Circuit Court of Appeals, Appellate Division First Department and Appellate Division Second Department.
Since Nov 2006

167. Peyrouton Law Blog RSS Feed

Peyrouton Law Blog RSS Feed jerseycriminalattorney.com/feed   Follow RSS Blog jerseycriminalattorney.com
New Jersey Criminal Lawyers - Dedicated to defending & protecting people charged with crimes

168. The Law Office of Rodemer & Kane RSS Feed

The Law Office of Rodemer & Kane RSS Feed   Follow RSS Blog coloradospringscriminaldefense.net
Posts on Criminal defense, Colorado Domestic Violence Defense, Colorado Misdemeanor Defense, and generic legal information. Steven Rodemer is a Colorado Springs Criminal Defense Attorney specializing in DUI, DWAI, and domestic violence defense.

169. Donich Law Blog RSS Feed

Donich Law Blog RSS Feed mydefence.ca/category/crimin..   Follow RSS Blog mydefence.ca
Toronto Law Firm providing legal solutions in Criminal Defence, Professional Regulation and Civil Litigation.

170. The Law21 Blog RSS Feed

The Law21 Blog RSS Feed law21.ca/feed   Follow RSS Blog law21.ca/blog
Jordan Furlong, a prominent analyst of the global legal market, offers invaluable insights into its evolution. Legal firms seek Law21 consultancy to grasp radical changes and build sustainable enterprises. Jordan advises lawyers on crafting competitive strategies to thrive in the evolving legal services landscape.
Twitter Followers 16.5K

171. Beyond Billables Blog RSS Feed

Beyond Billables Blog RSS Feed   Follow RSS Blog beyondbillables.com
From marketing strategy to personal branding, social media to inspiring stories, the blog is all about free advice for anyone with the ambition to make something great of their business. Beyond Billables are branding experts for legal and professional firms and specialise in assisting law firms and professionals build valuable reputations.
Facebook Followers 3.8KInstagram Followers 4.2K Frequency 2 posts/year

172. Sentencing Law and Policy RSS Feed

Sentencing Law and Policy RSS Feed sentencing.typepad.com/sente..   Follow RSS Blog sentencing.typepad.com
Sentencing Law and Policy blog provides information and commentary about guidelines and capital sentencing. Professor Berman is the sole creator and author of the Sentencing Law and Policy blog. Professor Berman provides consulting services on various cutting-edge federal sentencing issues. He also is frequently contacted by the media concerning sentencing developments.
Twitter Followers 4.9K Since May 2004

173. Ruth Carter Blog RSS Feed

Ruth Carter Blog RSS Feed feeds.feedburner.com/CarterL..   Follow RSS Blog carterlawaz.com
Carter Law Firm provides legal services in the areas of intellectual property, social media law, business law, & flash mob law. Ruth Carter is an Arizona business attorney, Phoenix business lawyer, intellectual property, internet law - Lawyer. Author. Professional Speaker.
Facebook Followers 896Twitter Followers 2.8K

174. In-House Ops RSS Feed

In-House Ops RSS Feed inhouseops.com/feed   Follow RSS Blog inhouseops.com
In-House Ops is published by Law Business Media. For almost 25 years, Corporate Counsel Business Journal (formerly Metropolitan Corporate Counsel) has delivered leading-edge information to the in-house community. MCC's founder, Al Driver, former General Counsel of one of the world's leading retailers, was committed to partnering with the world's leading corporate law department leaders and outside counsel from elite law firms to deliver the essential information needed to be a successful general counsel.
Facebook Followers 214Twitter Followers 3.3K Since Feb 2016

175. The Legal Satyricon RSS Feed

The Legal Satyricon RSS Feed feeds.feedburner.com/TheLega..   Follow RSS Blog randazza.wordpress.com
The primary goal of Randazza Legal Group is to protect your freedoms. We defend your right to speak freely, to control and protect your creative work, to be treated without discrimination, and to be free from harassment when people don't like what you have to say.
Facebook Followers 669Twitter Followers 14.7K

176. Northwest Business Law Blog RSS Feed

Northwest Business Law Blog RSS Feed   Follow RSS Blog nwbizlaw.com
Key topics covered are Business Law, Breach of Contract, Business Assets, Corporate Law Suits, Intellectual Property Litigation, and Partnership disputes. Northwest Business Law's mission is to assist entrepreneurs and small to mid-size companies in the navigation of their legal needs and business strategies.

177. Charles Griffin Intelligence » Ethical Investigator RSS Feed

Charles Griffin Intelligence » Ethical Investigator RSS Feed ethicalinvestigator.com/feed   Follow RSS Blog charlesgriffinllc.com
The Ethical Investigator by Charles Griffin Intelligence covers asset search, due diligence, and other private corporate investigation matters. Charles Griffin Intelligence is a New York-based consulting firm that assists lawyers, corporations, and individuals with fact-finding for global litigation and due diligence.
Facebook Followers 8Twitter Followers 641 Frequency 2 posts/year Since Mar 2011

178. The Expert Institute RSS Feed

The Expert Institute RSS Feed expertinstitute.com/resource..   Follow RSS Blog expertinstitute.com
Blog posts cover Legal News, Expert Insights, Legal Tech Solutions, Litigation Monitor, Trial Tactics, Cross-Examination, and Establishing Damages & Liability. Expert Institute is the leading expert witness services firm that connects attorneys with the exceptional expertise they need to win more cases.
Facebook Followers 1.6K

179. Senft Injury Advocates Blog RSS Feed

Senft Injury Advocates Blog RSS Feed   Follow RSS Blog senftinjuryadvocates.com
Scott Senft and his team of law experts provide you with diverse possible solutions to your legal issues and explain them to you.
Twitter Followers 15

180. The Blog for Business Law RSS Feed

The Blog for Business Law RSS Feed theblogforbusinesslaw.com/feed   Follow RSS Blog theblogforbusinesslaw.com
The Blog for Business Law is a blog about business, the law, and fun. The lawyers regularly post articles and alerts on emerging business, legal, judicial and regulatory developments in areas such as intellectual property, human resources, construction and real estate, environmental compliance, and the many, many considerations that arise when buying and selling businesses.
Twitter Followers 216

181. Mack's Criminal Law Blog RSS Feed

Mack's Criminal Law Blog RSS Feed mackscriminallaw.com/law-blo..   Follow RSS Blog mackscriminallaw.com
Mack's Criminal Law Blog provides insight, information and resources. It is dedicated to providing up-to-date and insightful information and blog posts on Canadian criminal law. It is an invaluable resource for criminal lawyers, judges and students.
Twitter Followers 715

182. Foley Hoag Blog » Security, Privacy And The Law RSS Feed

Foley Hoag Blog » Security, Privacy And The Law RSS Feed securityprivacyandthelaw.com..   Follow RSS Blog foleyhoag.com
Security, Privacy And The Law provides legal perspectives on the expanding universe of information security and privacy issues. Foley Hoag is a law firm that represents public and private clients in a wide range of disputes and transactions worldwide.
Facebook Followers 766Twitter Followers 3.7K Frequency 9 posts/year Since Oct 2008

183. Gore & Kuperman PLLC Blog RSS Feed

Gore & Kuperman PLLC Blog RSS Feed goreandkuperman.com/blog/feed   Follow RSS Blog goreandkuperman.com
Follow this blog to find factful information about Criminal Laws, Personal Injury Laws, Civil Litigation and get top answers form Mark Gore & Boris Kuperman.
Facebook Followers 1.1KTwitter Followers 90 Since May 2018

184. LAWPHILIC RSS Feed

LAWPHILIC RSS Feed lawphilic.law.blog/feed   Follow RSS Blog lawphilic.law.blog
Consistent & committed to providing legal awareness, opportunities and knowledge via our legal videos, write-ups, posts, and much more.
Facebook Followers 61Twitter Followers 5Instagram Followers 77 Frequency 2 posts/year

185. Corporate Law and Governance RSS Feed

Corporate Law and Governance RSS Feed corporatelawandgovernance.bl..   Follow RSS Blog corporatelawandgovernance.blogspot.com
His site's primary focus is the UK but interesting items from other jurisdictions are often included as are developments in the allied disciplines of capital market regulation and financial reporting.
Twitter Followers 177 Since Jan 2008

186. Online Legal Translations RSS Feed

Online Legal Translations RSS Feed onlinelegaltranslations.com/..   Follow RSS Blog onlinelegaltranslations.com
Online Legal Translations provides Quality Legal Translations performed solely by Lawyer-Translators. We provide quality, professional translation services for Corporate Legal Departments, Law Firms, Government Entities, and Individuals.
Facebook Followers 1.3KTwitter Followers 237Instagram Followers 223 Since Oct 2017

187. Legal Docs A2Z Blog RSS Feed

Legal Docs A2Z Blog RSS Feed legaldocsa2z.com/feed   Follow RSS Blog legaldocsa2z.com
Orange County Divorce Attorney |LegalDocsA2Z encourages Amicable divorce flat fee $599 with kids, $499 no kids, save your money and time
Facebook Followers 1.4KInstagram Followers 35 Frequency 4 posts/year

188. Wheeler Law Firm, LLC Blog RSS Feed

Wheeler Law Firm, LLC Blog RSS Feed awheelerlaw.com/feed   Follow RSS Blog awheelerlaw.com
Wheeler Law Firm is an experienced Family Law Firm serving Indianapolis and surrounding areas.
Facebook Followers 269

189. Sinka LLC Blog RSS Feed

Sinka LLC Blog RSS Feed sinkallc.com/feed   Follow RSS Blog sinkallc.com
Sinka llc is a proactive boutique law firm, with a global perspective and attention to detail. We are based in Cyprus and represent closely-held businesses, families, and high net worth individuals.
Twitter Followers 3K

190. Elawvation Blog RSS Feed

Elawvation Blog RSS Feed elawvation.com/feed   Follow RSS Blog elawvation.com
Tools and news for lawyers, attorneys. Wellness and wellbeing news. Work-life balance secrets. Lawyer's life. Fashion for lawyers
Facebook Followers 253Instagram Followers 1.1K

191. Khashan Law Blog RSS Feed

Khashan Law Blog RSS Feed khashanlaw.com/feed   Follow RSS Blog khashanlaw.com
The Khashan Law Firm is a full-service general practice law center representing clients throughout Southern California in a wide array of legal issues. Although the Khashan Law Firm primarily focuses on representing individuals injured in all types of accidents, our Attorneys have a wide variety of experience and knowledge and have represented thousands of clients in serious Personal Injury cases and more.
Facebook Followers 1.3KInstagram Followers 797 Since Nov 2017

192. LAW GOVERNANCE RESPONSIBILITY RSS Feed

LAW GOVERNANCE RESPONSIBILITY RSS Feed aishmghrana.me/feed   Follow RSS Blog aishmghrana.me
Writer of this blog, Aishwarya Mohan Gahrana is Practicing Company Secretary and Insolvency Professional working with M/s Aishwarya M Gahrana & Associates, a New Delhi based peer reviewed firm of company secretaries having pan India presence through friends and associates.
Facebook Followers 6.5KTwitter Followers 979Instagram Followers 214 Since Feb 2011

193. Bagneris Law Firm Blog RSS Feed

Bagneris Law Firm Blog RSS Feed bagnerislawfirm.com/feed   Follow RSS Blog bagnerislawfirm.com
Suzette Bagneris is the owner of the Bagneris Law Firm located in New Orleans, Louisiana. She brings unparalleled passion and compassion to each case. Personal Injury and Criminal Litigation Firm that has consistently obtained multi-million dollar settlements and verdicts for clients in Louisiana. The firm is an experienced civil litigation firm with decades of combined experience serving both plaintiffs and defendants in a wide range of different cases. These different legal cases include both personal injury cases and business disputes.
Facebook Followers 436Twitter Followers 40 Since Oct 2018

194. Louis Lehot Blog RSS Feed

Louis Lehot Blog RSS Feed louislehot.com/feed   Follow RSS Blog louislehot.com
Keep up with the latest news and updates on the Louis Lehot blog. Louis Lehot helps businesses and ventures with compelling technologies reach their growth objective with sound legal strategies and solutions.
Facebook Followers 9.3KTwitter Followers 1.3K

195. The Cyprus Lawyer RSS Feed

The Cyprus Lawyer RSS Feed thecypruslawyer.com/feed   Follow RSS Blog thecypruslawyer.com
The life and practise of a lawyer in Cyprus. Harris Sharpe is a qualified lawyer practising in Cyprus with extensive experience in corporate and commercial law.
Facebook Followers 750Twitter Followers 493

196. Ernest G. Ianetti, Esq. RSS Feed

Ernest G. Ianetti, Esq. RSS Feed ianetti.legal/answers?format..   Follow RSS Blog ianetti.legal
Over 30 Years of Professional Experience in Bankruptcy, Family Law, and Criminal Law. Personal, practical solutions to complex bankruptcy, family law & criminal defense legal matters.
Facebook Followers 4

197. MLB RSS Feed

MLB RSS Feed malasevschi.wordpress.com/feed   Follow RSS Blog malasevschi.wordpress.com
The M|L|B is an initiative which aims to approach important decisions of national and EU courts and law related issues.
Facebook Followers 246Twitter Followers 35Instagram Followers 657

198. Cultural Heritage Lawyer RSS Feed

Cultural Heritage Lawyer RSS Feed culturalheritagelawyer.blogs..   Follow RSS Blog culturalheritagelawyer.com
A lawyer's commentary on cultural property law and cultural heritage law; the illegal antiquities trade; looted, stolen, smuggled, and illicit artifacts; art theft; museum administration and risk management; and the laws and lawyers impacting cultural heritage, cultural property protection, antiquities dealers, auction houses, and archaeology.
Twitter Followers 3.3K Since Jan 2010

199. Iowa Employment Law Blog RSS Feed

Iowa Employment Law Blog RSS Feed iowaemploymentlawblog.com/feed   Follow RSS Blog iowaemploymentlawblog.com
Iowa Employment Law Blog is written by Patrick Smith of Bradshaw Fowler Proctor & Fairgrave, PC's Employment & Labor practice group focusing on matters related to employment & labor litigation, disputes, benefits, unfair practice, and wage & hour claims in Iowa.
Twitter Followers 52

200. Gordon Rees Scully Mansukhani Construction Law Blog RSS Feed

Gordon Rees Scully Mansukhani Construction Law Blog RSS Feed grconstructionlawblog.com/feed   Follow RSS Blog grconstructionlawblog.com
Gordon & Rees Construction Law Blog is a forum on Key Legal Issues for Design Professionals, Contractors and Developers.
Twitter Followers 1.3K

201. The Pink Attorney Blog RSS Feed

The Pink Attorney Blog RSS Feed specificfeeds.com/thepinkatt..   Follow RSS Blog thepinkattorney.com
A blog tackling legal issues and life experiences with honesty, integrity and a dash of humor!
Frequency 1 post/year

202. Power Legal Group PC Blog RSS Feed

Power Legal Group PC Blog RSS Feed powerlegalgroup.com/blog/feed   Follow RSS Blog powerlegalgroup.com
LA Personal Injury Lawyer Bobby Yaghoubian started the Power Legal Group because he wanted to have a Los Angeles law firm that offered aggressive representation combined with personalized service. They are dedicated to serving all of the people of Southern California from all walks of life and pursuing maximum compensation in every case they take.
Facebook Followers 80Twitter Followers 18

203. Mass Tort Lawyers RSS Feed

Mass Tort Lawyers RSS Feed masstortlawyer.org/feed   Follow RSS Blog masstortlawyer.org
We are Top Attorneys Handling Mass Tort Litigation and Class Action Lawsuits.
Facebook Followers 3KTwitter Followers 231Instagram Followers 2.2K

204. Export Law Blog RSS Feed

Export Law Blog RSS Feed exportlawblog.com/feed   Follow RSS Blog exportlawblog.com
On the Export Law Blog, Clif Burns provides latest news on DDTC, BIS, OFAC, and other export law matters. Mr. Burns is a Bryan Cave LLP attorney specializing in export control and economic sanctions.
Twitter Followers 513 Since Nov 2013

205. Real Legal News RSS Feed

Real Legal News RSS Feed reallegalnews.com/feed   Follow RSS Blog reallegalnews.com
Real Legal News (RLN) is a collection of legal news and information from in house reporters and local attorneys. Our goal is to inform and educate the public about everything legal.
Since Oct 2019

206. softrights RSS Feed

softrights RSS Feed thaworldtakes.com/feed   Follow RSS Blog thaworldtakes.com
This blog aims to entertain and inform, in that order. Want legal advice? Look elsewhere. Better yet, call me!
Since Apr 2012

207. Welcome to the law basic RSS Feed

Welcome to the law basic RSS Feed laymanlawbasics.blogspot.com..   Follow RSS Blog laymanlawbasics.blogspot.com
A blog about basic facts, environment related topics, general topics and law related information.

208. Pecori and Pecori Attorneys at Law RSS Feed

Pecori and Pecori Attorneys at Law RSS Feed pecorielderlaw.blogspot.com/..   Follow RSS Blog pecorielderlaw.blogspot.com
Pecori & Pecori is a third generation law firm founded in 1940. We offer the high-quality personal service that only a small firm can provide. Whether you need a Pittsburgh Estate Planning Lawyer, a Pittsburgh Probate Lawyer or a Pittsburgh Elder Law Lawyer, we can help you.
Since Feb 2020

209. Estrin Legal Staffing Blog RSS Feed

Estrin Legal Staffing Blog RSS Feed estrinlegalstaffing.com/feed   Follow RSS Blog estrinlegalstaffing.com
Over 25 years of staffing experience in AmLaw200 law firms and in-house legal departments. We practice ethical recruiting and offer clients and candidates top-tier service. You'll get the benefit of our proven track record as we work hard for you whether we are recruiting for you or helping you find that dream job.
Facebook Followers 23 Frequency 1 post/year

210. Flock of Legals RSS Feed

Flock of Legals RSS Feed flockoflegals.com/feed   Follow RSS Blog flockoflegals.com
Covers articles on California Criminal Law, DUI Law, Personal Injury Law, Traffic Tickets, and more. Flock of Legals is created by California lawyers with the primary goal of creating a free legal database of legal information accessible to all.
Facebook Followers 135Twitter Followers 21 Since Mar 2018

211. Clark Hill RSS Feed

Clark Hill RSS Feed hoban.law/feed   Follow RSS Blog clarkhill.com
Stay up to date with Cannabis Industry Insights. Hoban Law Group is an industrial hemp & cannabis industry law firm, recognized in the canna-business, industrial hemp farming, and hemp production community
Facebook Followers 3KTwitter Followers 2.2K

212. Seda Law Firm PLLC Blog RSS Feed

Seda Law Firm PLLC Blog RSS Feed   Follow RSS Blog sedalawfirm.com
Covers articles related to estate planning, probates, and real property matters. Seda Law Firm PLLC is based in Oklahoma City serving clients in Oklahoma, Texas, New Mexico and North Dakota.
Facebook Followers 601Twitter Followers 3

213. KS Legal and Associates Blog RSS Feed

KS Legal and Associates Blog RSS Feed kslegal.co.in/feed   Follow RSS Blog kslegal.co.in
KS Legal and Associates blog contains posts on various legal-related information, such as family, divorce, property, insurance, banking, commercial, etc. As a boutique law firm, KS Legal provides top-quality advice on corporate and commercial law for everyone from blue-chip companies to start-ups and is a go-to for international firms and clients.

214. Cohen Seglias Blog » Construction Law Now RSS Feed

Cohen Seglias Blog » Construction Law Now RSS Feed constructionlawsignal.com/feed   Follow RSS Blog cohenseglias.com
Construction Law Signal is written by the Construction Lawyers at Cohen Seglias Law Firm and offers legal updates and insights on Construction matters. The blog is designed to provide regular news on construction related issues in the Mid-Atlantic region, with practical commentary and analysis from the Cohen Seglias Construction Group.
Facebook Followers 185Twitter Followers 520

215. Zegal Blog RSS Feed

Zegal Blog RSS Feed   Follow RSS Blog zegal.com
Covers articles on small business legal and commercial issues, latest legal and business tips, tools and resources. Zegal is the end-to-end platform for the legals smaller companies need.
Facebook Followers 3.1KTwitter Followers 1.6K

216. Scarinci Hollenbeck » Law Firm Insights RSS Feed

Scarinci Hollenbeck » Law Firm Insights RSS Feed   Follow RSS Blog scarincihollenbeck.com
Articles feature the latest firm insights and topics including Business Law, Entertainment and sports, Labor and employment, IP, Cybersecurity, Environmental law, Cannabis, Tax, and more. Scarinci Hollenbeck is a full-service, general practice business law firm that provides a broad range of legal services to a diverse group of clients.
Facebook Followers 1.9KTwitter Followers 7.2K

217. Sheria Na Jamii Blog RSS Feed

Sheria Na Jamii Blog RSS Feed sherianajamii.blogspot.com/f..   Follow RSS Blog sherianajamii.com
A blog about legal articles, cases, legal documents, substantive laws, procedural laws, and other legal affairs worldwide. Sheria Na Jamii is a free online platform for varieties of legal content on selected topics of several legal affairs worldwide.
Twitter Followers 716

218. Attorney-At-Law Journal RSS Feed

Attorney-At-Law Journal RSS Feed attyatlawjournal.blogspot.co..   Follow RSS Blog attyatlawjournal.blogspot.com
Attorney-At-Law Journal is a pesonal blogsite sharing the pursuits in life, law and love
Since Aug 2012

219. Vanderbilt JETLaw Blog RSS Feed

Vanderbilt JETLaw Blog RSS Feed   Follow RSS Blog vanderbilt.edu
JETLaw is committed to reaching a wide audience by providing a forum for dialogue between scholars, students, and practitioners on all legal matters pertaining to the fields of entertainment and technology. The Vanderbilt Journal of Entertainment and Technology Law is an official, highly ranked, student-run publication of Vanderbilt University Law School and publishes four issues annually.
Facebook Followers 333Twitter Followers 319

220. Sports and Entertainment Law Insider RSS Feed

Sports and Entertainment Law Insider RSS Feed sportslawinsider.com/feed   Follow RSS Blog sportslawinsider.com
Sports and Entertainment Law Insider is your all-access pass to the latest legal developments impacting the business of sports and entertainment.
Since Jun 2012

221. Expert Witness Blog RSS Feed

Expert Witness Blog RSS Feed advancedassessments.co.uk/Bl..   Follow RSS Blog advancedassessments.co.uk
The Advanced Assessments blog offers expert insights into psychological assessments and mental health evaluations. Authored by Dr. Shaun Davis and his team, the blog covers a range of topics including forensic psychology, clinical assessments, and therapy. The goal is to provide valuable information and resources for individuals and professionals seeking to understand and improve mental health through comprehensive assessments.
Facebook Followers 170Twitter Followers 3.3K

222. Race and the Law Prof Blog RSS Feed

Race and the Law Prof Blog RSS Feed lawprofessors.typepad.com/ra..   Follow RSS Blog lawprofessors.typepad.com
Law Professor Blogs, LLC is the nation's only network of legal blogs edited primarily by law professors. Law Professor Blogs, LLC's legal blogs are edited by over 100 law professors, deans, and lawyers. Editors include leading scholars and educators who are committed to providing the web source of legal news, information, commentary, and analysis for law professors, practitioners, government and nonprofit lawyers, and students in their respective fields. Most of the network's blogs are owned by Law Professor Blogs, LLC. Several blogs are affiliates of the network.
Twitter Followers 857

223. Overlawyered RSS Feed

Overlawyered RSS Feed overlawyered.com/feed   Follow RSS Blog overlawyered.com
Overlawyered, published by the Cato Institute in 2013, began in July 1999 and is regularly described as the oldest law blog; at least, no one seems to be able to name one that's older. Its founder and predominant writer are Walter Olson, a senior fellow at Cato and author of several books about the U.S. legal system including The Litigation Explosion, The Excuse Factory, The Rule of Lawyers, and Schools for Misrule.

Show 224 to 8568